KEGG   Drosophila erecta: 6542288Help
Entry
6542288           CDS       T01060                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
der  Drosophila erecta
Brite
KEGG Orthology (KO) [BR:der00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:der04131]
    6542288
Membrane trafficking [BR:der04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    6542288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 NUC130_3NT
Motif
Other DBs
NCBI-GeneID: 6542288
NCBI-ProteinID: XP_001968115
FlyBase: FBgn0116824
UniProt: B3N767
Position
Unknown
AA seq 2064 aa AA seqDB search
MSNAQRSFVQKVSKQSAADVRKNVSGCHLSKAIDSSLCGSSVSPTEPLDYEEFLSQHMNI
INRDPLKQILDFPQGDVTVKIIPRKIRTVDHVIPNENLSDLPHHVQECVNCYTRPWKVVE
YAQRHLSSSCYIRERIDRGTISPSAYQQEFEIDKDFSSFEEAFAYKSESCTPSSRQSIAS
LASVSSCTDTLTPRGSWASFDLRRSVNDPLIPNLLDNVPPEHIDQSNEARRQQDRQMALF
SLYPESEAEECIERRLLAEIPVEHMGHRIQVKCLQLRLELEVEPIFASMAIYDAKERQKI
SENFYFDMNADSLKRMLSSHVQCADISTQSHSAIFEISYPSNDLFLVIRLEKVLQGDINN
SVEPYLKEDKDKYREKVKSNAVDYCERLGKYRMPFAWTGIYLTNVFNGDNFESKDAGAAE
RDSFGSGTGSSLGTAASSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERKEKHRSWS
PDDFANVVENFRPITITVPSFFKQEPDKMKDEDLYKILPELKRPGSVMKKYKCIPGSIKL
EISPCVEEAKNALTPELASINPQSADNVRPVKEILEFPQSAIYNPHYTYRNLLFVSPKEL
NFSSRAGSARNIAVRVQLMAGETPKDAVNAIYGKSSCPKFSTEAFTAVNYHNKCPSFYDE
IKIALPASIKQHHHLLFTIYHVSCQKKPQDLQPSVETPIGYTWLPLLEDGKLKFGEFNLP
VMVESPPENYSFIPPNVHLPGIKWLDNHRAVFSINVEAVTAIHTLDSFLDRFFLICEYLD
TRNIPSHIGENNIETELKKCLLDIEYANREPLVRHLPLVLDKLIELLVVTHKVSGQAMSL
GSTVFEVLCLVSSLLSILNDDQYDQYGRQSLLSTYVQFQCKIPHPFQSKQRLTCSRSTTE
DLQLSESYTLYDNVLASGRSLDRKEISIDILQSMAARDVQVRLLHEELALHWVVASGKAA
DLAMSNSWFLFELIVKSMIEHLHCSNTLNGPRKHRFPHQFNDDLSTLVHLVTTKVVGYHS
NEPKLAQSLNASLGFFIFDILSIMDRGFVFGLIKTYTKVLISKNASIPDLMNYKIDFLRI
VCSHEHFVALNLPFGTSYTMVTAPCSPTPSTTSSNSQTSCGSLDRALHADLSQEFLQQHF
LIGLVLSDLAAVMEVPNPQLHGKAIRCIRNLMTSHDLDARYSETDARARVAALYIPLLSI
VMDSIPQLHQHGLEQDRLQQIGQLEDYQGPHQTITTSTINPEVAFAISGSRPYSYLNEQV
KNKLPLSSENTRHLLVCFLWVLKNLERNVLYRWLLDLSPHRVHQMLQGVNVCLKTFEYTG
QKNVATLKRTNTQSFRKTASTDVKEKLEECIRGTNSARYDLINRRKDRNSTEKFRWRKDQ
MPYRSQYSDGVGKSEHELELSHFIEGSLATEVALVLLDTLEIIVHVAANLYHNLLGTVLK
VLLHSLSRNQSTLALQNLFASQRALIFKFPNLLFDDETDICADLCLILLKHCGSLLPGIR
SQAAASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSSVFSEQSLRRALKTVLVYAES
DSDLQETSFPEQVQDLLFNLHMILSDTVKMKEYQEDPEMLLDLMNRIAKGYQNNPDLRLT
WLENMAKKHRERANHTEAAMCYVHAASLVSEYLSMLESQTHLPVGAVSFQRISPNTLMES
AVSDDVLSPGEDGICLGNHFTETGLKALLEEASNSFQVAGMYEAMNEVYKILIPICEANR
DFQKLSKVHGKLQEAFNRISQLQGKRVFGTYFRVGFYGGKFGDLDQQEFIYKEPTLTKLP
EIFSRLQNFYTERFGPDSVHIIKDSNTVDVNSLDPDKAYIQITYVEPYFETYEMRHRETY
FERNFNIKRFIYATPFTKNGKAHGELHEQCKRKTILTTANHFPYVKTRIMVISRQQIVLE
PIEVAIEDIQKKTLELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMASVFLSNLSDG
TTVPTKHQNKLRLCFREFSKRCADALKKNRNLILSDQKDYQRELERNNDRFIERLTPFIT
LTSVQNHGVVKANAYNNKSTPLKW
NT seq 6195 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgcccagcgctcgtttgtgcaaaaagtttcaaagcagtcggctgcggatgta
cgaaaaaatgtttctggttgccatttatcaaaggcaatagactcgtcactgtgtggttcg
tcggtgtccccgacagagcctcttgattacgaagaatttctttcgcagcatatgaacatt
atcaaccgggaccccttgaaacaaatactggactttcctcaaggagatgtaactgtaaaa
atcattccccgaaaaatccgaactgttgatcacgttattcccaacgagaatttgtctgat
ttgccccatcacgtacaagaatgtgtgaactgctatacgcgcccatggaaggtggtggaa
tatgcacagcggcacctttccagctcttgctatatccgcgagcgtatcgaccgcggaacc
ataagtccctccgcgtaccagcaggaattcgagatcgacaaggatttttcgtcatttgaa
gaagcattcgcctataaaagcgaaagctgcactccaagttctcggcaatccattgcaagt
ttggcttcagttagctcttgtacggacactttgacaccgcgtggttcttgggctagcttt
gatcttcgacgctcggttaatgacccactaatacccaatttgcttgacaatgtacctccg
gagcatattgatcagtccaatgaagcacgccggcagcaagatcgacaaatggctcttttc
tcactgtatccggaatctgaagcggaggaatgcattgaacgccgcctgctcgcggagatt
cctgttgaacatatgggtcatcgcattcaggttaaatgcctacagcttcggcttgagctg
gaagtagaaccaatttttgcatcgatggccatctatgatgctaaagaacggcaaaaaatt
tcagaaaatttctattttgacatgaacgcagatagtcttaaacgcatgttgtcaagtcat
gtgcagtgcgcagacataagtacccagagccactcagccatatttgaaatttcatatccg
agtaatgatttgtttctcgtgattcgtctggaaaaagttttgcagggtgacataaacaat
tctgtcgagccgtatctcaaggaagacaaagataaataccgagagaaagtaaaatccaac
gcggtagactactgtgagcgactaggcaagtaccgaatgccgtttgcatggacaggaatc
tacctcacaaatgtttttaatggcgataactttgaaagcaaagacgctggcgccgcggag
cgggattctttcggaagtggtacgggcagcagcttgggtacagcggcaagctccaatagc
ttagatcgtaagtcttccacaagtagctttgatcaactaaggcgaaaggcgaacgatatg
agcggaacactaacccgacgcggttcgcttgaacgaaaggagaagcaccgatcctggtct
ccagatgactttgcaaacgtggtagaaaactttcgtcctatcactataacagtaccaagc
ttcttcaaacaagagccagataaaatgaaagacgaggatttgtacaaaattttaccagag
ctaaaaagaccgggttcagttatgaagaagtacaaatgcataccaggttctattaaatta
gaaatatcaccatgcgtcgaggaagccaagaatgccttaactccagagttggccagtatt
aaccctcaaagtgcggataacgttcgcccagttaaagaaattttagaatttccgcaatcg
gcaatttacaacccacattatacctatcgcaatctgctctttgtgtcaccaaaggagcta
aatttctcctcgcgtgcaggatctgctcgaaacattgccgttcgcgtacaactaatggct
ggagaaaccccaaaagatgcggtcaatgccatctacggcaagtcgtcttgtccaaaattt
tctactgaagcatttacggcggtcaattatcataacaaatgcccatctttctacgatgaa
ataaaaatagccctgcctgcatcaataaaacagcatcaccatttattgtttaccatttac
cacgtttcatgtcaaaagaaaccgcaggatttgcagccgtcagtagagacccctatcggc
tacacatggttgcccttactggaagatggaaaacttaaatttggagaatttaatcttcct
gttatggtagaatcaccaccggaaaattactcttttataccaccgaatgttcatctgcct
ggaattaaatggctggacaatcacagagctgtgttttcaattaatgtagaagcagtgacc
gcaattcatactttggattccttccttgatcgattcttcttaatttgcgaatatctagac
actcgaaatataccttcccacattggtgaaaataatatagagacagaattaaagaaatgc
ttgctggatatcgaatatgcaaatcgtgagccattagtgaggcatctaccattagtcttg
gataagcttattgaattgctggtagtgacccacaaagttagtggacaagcaatgtctctg
ggatctacggttttcgaagttctttgcttagtatcatctttgttgtcaatacttaatgac
gatcaatatgaccaatacggacggcaaagtttgctatcaacatatgtgcaatttcaatgt
aaaattccgcacccatttcaaagcaaacagcgactaacatgcagtcgcagcacaacagag
gacttgcaattaagcgaatcgtacaccctatatgataatgtgctagcaagtggccgaagt
ttggatcgcaaagaaatatccatagatatccttcaatcgatggctgctcgggatgtccaa
gtcaggctgctgcacgaagaattagccctgcattgggtcgttgcaagtggaaaggcagca
gacttagccatgtcaaattcgtggtttttatttgagcttatagtcaaatctatgattgaa
catttgcattgttcaaatactttgaacggtccccgcaaacatcgatttcctcatcagttt
aatgatgatctatccaccctggtgcacttagttacaacaaaagttgtcggctaccatagt
aacgaacctaaattagcgcagtcattaaatgcaagtttaggctttttcatatttgacata
ctaagcatcatggatcggggatttgtgttcggcctgatcaaaacgtacaccaaggttttg
atttctaagaatgcttcaatacctgatctaatgaactataaaatagacttcttaagaatt
gtctgtagtcatgagcactttgttgctttaaacttgccgtttggaacctcatacacaatg
gtaactgcgccttgcagtcccactccaagcacaacgtcgagcaacagccaaacttcttgc
ggatcactagacagagctctacacgctgaccttagtcaagaattcctccagcaacatttt
ctaatcggtcttgtactgagcgatttggcagcagtaatggaggtgccaaacccccaatta
catggaaaagcgattcggtgtattcgcaacctaatgacatctcacgatttggacgctcgg
tatagcgaaactgatgcgcgtgcaagggtggctgctttatacataccgcttctttccata
gtgatggattccattcctcagctgcatcagcacggccttgagcaagatcgtctgcagcaa
atcggtcaacttgaagactatcaaggaccacatcaaactattacaacatcaaccataaat
ccggaagtggcatttgcaatatcgggaagtcgtccctactcctacttgaatgaacaggtt
aaaaacaagttaccccttagctcagagaatactcgccatttattggtgtgttttctgtgg
gtgctaaaaaacttggagcgcaacgttttataccgctggcttttggatttaagtccgcat
agagtgcaccaaatgcttcaaggtgttaatgtttgcctgaaaactttcgagtacaccgga
caaaaaaacgtcgccactcttaaacgaacgaatacacaaagttttaggaaaactgcatct
actgatgttaaggaaaagttggaggaatgtattagaggcacaaattcagcacgttatgat
ttaataaatcgccgaaaagatcgtaattcaacagagaaattccgctggaggaaagaccag
atgccatatcgctcacaatattctgatggagtgggaaaaagtgagcatgaacttgaattg
agtcattttatcgaaggctctttggctactgaagttgctcttgtactgctcgataccctg
gaaattattgttcatgttgctgccaacctgtatcataatcttcttggaactgtactgaag
gtgcttctgcattctttgtctcgaaatcaatctactttggccctgcaaaacttgtttgcc
tcccagcgcgcattaatttttaaatttccaaatttattattcgacgacgagaccgacata
tgtgcggatttgtgtctgattttgctaaaacattgcggatcccttttgccaggaatacga
tcacaggctgctgcatcactatatttactaatgagacaaaatttcgaaattggaaataac
tttgcccgagttaagatgcaagtgacgatgtctttaagctccctggttgggacaagttcg
gtatttagtgagcaatctttacgccgtgcgcttaaaacagtgctagtttatgctgaatcc
gactccgacctgcaggagacatcttttcctgagcaagtacaagatttgctttttaacctg
catatgatactgtcagatacagtaaaaatgaaggagtatcaagaagatccagagatgttg
cttgacctcatgaatcgtattgccaaaggataccaaaataaccctgatctacggctgact
tggctggaaaatatggctaaaaaacaccgcgagcgggccaatcacacggaagcagccatg
tgctatgtacatgctgcttctttagtctctgaatatcttagcatgttggagtcacaaacg
catttgcctgttggagctgtaagttttcaacgaatttctcccaacacactaatggagtcg
gccgtgtctgatgatgtgctaagtcccggcgaggatggtatctgcctaggaaatcatttc
actgaaactgggctaaaggccttgctggaagaagcctccaattcctttcaagtagctggc
atgtatgaagctatgaacgaagtgtacaaaattctaatacccatatgcgaggctaacaga
gattttcaaaagctaagcaaagttcatggcaaattgcaggaggcatttaatcgaatatcc
cagctacagggtaagagagtttttggaacatactttcgtgttggcttctacggcggaaaa
ttcggagacttggatcagcaggaattcatttataaagagccaaccttgacaaagttgccc
gaaatatttagtcgactacagaatttttacactgaacgattcggaccggactctgtgcat
atcattaaagattccaatacagttgacgtaaatagtttggatcccgataaggcttacatt
caaataacttatgttgaaccctatttcgaaacatatgaaatgcgtcatcgtgagacatac
tttgaacggaatttcaatataaaacgttttatatatgccacgccttttaccaaaaatggt
aaggcccatggcgaactacatgagcagtgtaagcggaagacgatcttgaccacggcgaat
cactttccctacgtaaaaacacgcattatggtaattagcagacagcaaatagtcctggaa
cccattgaagtggcaattgaagatattcaaaaaaagacattggagttggcggctgccacg
aatcaagagccagcagaccccaaaatattgcaaatggtgctccagggatgtattggaacg
actgttaaccaaggaccgatggaaatggccagtgtattcctttccaatttatccgacgga
acaactgtaccgacaaagcaccaaaacaaacttcggttatgctttcgcgagttttcaaaa
cgttgtgctgatgctttgaaaaagaatcgcaatctaatactttcagatcaaaaagattac
caaagagaattggaacgtaacaacgaccggttcattgaacgattgactccttttattact
cttacatcagttcagaatcatggcgttgtcaaggccaacgcgtacaacaacaaaagtact
cctttgaaatggtaa

DBGET integrated database retrieval system