KEGG   Drosophila erecta: 6542465Help
Entry
6542465           CDS       T01060                                 

Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
der  Drosophila erecta
Pathway
der03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:der00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    6542465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:der03009]
    6542465
Ribosome biogenesis [BR:der03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    6542465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 6542465
NCBI-ProteinID: XP_001970090
FlyBase: FBgn0115714
UniProt: B3N662
Position
Unknown
AA seq 508 aa AA seqDB search
MFVLYETPAGYAIFKLLDEKKLEQVDNLYQEFETPEKANKLLKLKHFEKFNDTTEALAAA
TAAVEGKVAKPLKKTLKKLLVDDVQSSLLVADAKLGTAIKDKLSVQCVYNTGVQELMRCI
RQQADSLLGGLPKREMTAMALGLAHSLSRYKLKFSPDKIDTMIVQAQCLLDDLDKELNNY
MMRAREWYGWHFPELGKIITDNIAFVKTIKLVGTRDNMATSDLSDILPEDVEEKVKEAAE
ISMGTEISEEDVLNIQCLCDEIISINDYRTHLYDYLKARMMAMAPNLTVLVGDTVGARLI
AHAGSLINLAKHPSSTVQILGAEKALFRALKTKKDTPKYGLIYHAQLVGQASQKNKGKMS
RSLAAKASLATRVDAFGEEATFELGAAHKVKLESRLRLLEEGNLRKLSGTGKAKAKFEKY
QAKSEVFTYQPEADNTLNVKKRKHSESEQTPVKKEEAVEEDAEVKSEKKKKKKKKQKDEE
EAVEEAAAPEPEDQPTPAKKKKKSKHQE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgctctacgaaacgccggcgggctacgcgatttttaagctgctggacgaaaag
aaactggagcaggtggacaatctgtaccaggagtttgagactccggaaaaggccaacaag
ctgctgaagctgaagcactttgagaaatttaatgacaccacagaggcgctggccgctgct
acggcggcagtggagggcaaggtggccaagccgctgaaaaagaccctaaagaagctactc
gttgacgacgtgcagtcttcgctcttggttgccgatgccaaactgggcacagccatcaag
gacaagctgtccgtacagtgtgtctacaacactggcgtccaggagctgatgcgctgcata
cgccagcaggcagatagtctgctcggtggactacctaagcgggagatgaccgccatggcc
ttgggtctcgcgcactctttgtctcgctacaagctcaagttctcgcccgacaagatcgac
acaatgattgtgcaggcccagtgcttgctggatgacctggacaaggagctgaacaactac
atgatgcgtgcacgcgagtggtacggatggcattttcccgagctgggcaagatcatcacc
gacaacattgccttcgtgaaaaccattaaattggtgggcaccagggacaacatggccaca
agcgatttgtccgacattttgccagaagatgtggaggaaaaggtcaaggaggcggccgag
atctctatgggtaccgaaatctccgaagaggatgttctgaacattcagtgcctgtgcgac
gagatcatatcgattaacgattaccgcacccacttgtacgactacttgaaggccagaatg
atggccatggctccgaacttgacagtgctcgttggcgacacagtgggcgctcgactgatt
gcccatgctggctcgctgatcaacctggccaagcatccctcatccactgttcaaattctg
ggcgccgaaaaagccctcttccgtgcgctgaagaccaagaaggatacgccaaagtacggt
ttgatttatcacgcccagttggtgggacaggcaagccagaagaacaagggcaaaatgtca
cgctcgctggccgctaaagcatctcttgctactcgcgttgatgccttcggcgaggaggcc
acctttgagctcggagcggcacacaaggtaaaactagagtcgcggctgcgactgctggag
gagggaaacctgcgcaaactctcgggcaccggaaaggccaaggcaaagttcgagaagtac
caggccaagagtgaggtgttcacataccaaccggaggccgacaacaccttgaacgtgaag
aagcgcaagcactccgagtccgaacagacgcctgttaagaaggaggaagctgttgaggag
gacgcggaggtcaagtctgagaagaagaagaaaaagaagaagaagcagaaggacgaggag
gaggccgttgaggaggcggcagcccccgagcccgaggaccagccaacaccagcaaagaaa
aagaaaaagtcaaagcaccaggagtag

DBGET integrated database retrieval system