KEGG   Drosophila erecta: 6543647Help
Entry
6543647           CDS       T01060                                 

Definition
(RefSeq) alpha-1,3/1,6-mannosyltransferase ALG2
  KO
K03843  alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
der  Drosophila erecta
Pathway
der00510  N-Glycan biosynthesis
der01100  Metabolic pathways
Module
der_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6543647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:der01003]
    6543647
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.132  GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     6543647
    2.4.1.257  GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     6543647
Glycosyltransferases [BR:der01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   6543647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_trans_4_5
Motif
Other DBs
NCBI-GeneID: 6543647
NCBI-ProteinID: XP_001971347
FlyBase: FBgn0107158
UniProt: B3NF31
Position
Unknown
AA seq 424 aa AA seqDB search
MVRVLFLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVV
GDWLPRGLFGRFYAICAYLRMLYAAIYASFFMPQREKVDVVVCDLISVCIPVLRFAPHRP
KVLFYCHFPDQLLSSREGLLKWLYRLPINWLEEHTIGLADKVLVNSKFTLRVFQDTFRRL
STVPDVLYPSLHTQYFDQMQKKLEQRSALFDEPVHPRVPLNAFIYLDINRYERKKNHALG
LHSLRLLGDMLPANDFKRCRLIIAGGYDTRCMENVEHFAELEQLTEELKLQDHVVLLRSP
TDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVNTSTGFLCE
KTEKSFGGAMHQLFRDEQLRVKMGDQGHKRVQQKFSFQAFADRLNGIIRDLVPISKESSP
KKTE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggttcgagttctgttcctccacccggatttgggcatcggaggagccgagcgactggtg
gtggatgcagctctggctctcaaggagcgaggacaccaagtcagcttcctaacgaatcac
cacgacagcacgcactgcttcaaggagacggctgacggcacttttccggttcacgttgtg
ggggactggttgccacgcgggctctttggaagattctacgccatctgtgcgtatctgcgc
atgctctatgcggcgatctatgccagcttcttcatgccccagcgggagaaggtggatgtg
gtggtgtgcgatctaatctctgtatgcattccggtactccgcttcgctcctcatcgtccg
aaagttctattctactgccacttcccggatcagctcctcagcagccgtgaaggtctgctg
aagtggctgtaccgtctgcccatcaactggctggaggagcacaccatcggtctggcagat
aaggtgctggtcaattccaagtttacgctgcgagtcttccaggacaccttccgccggctg
agcacggtgccggatgtgctgtatccttcactgcacacccagtattttgaccagatgcag
aaaaagctggagcagcggtctgctttatttgacgagcccgtgcatccgcgagtgccactc
aacgccttcatctatctggacatcaatcggtacgagcgaaagaagaaccacgcacttggc
ttacattccctgcgtctcctgggcgacatgctgcccgccaatgacttcaaacgctgtcga
ctgatcatcgcggggggctatgacactcgatgcatggaaaatgtcgagcactttgcggag
ctggagcagctcacggaggagcttaagcttcaggatcacgttgtgttgctgcgctcgcct
accgacgaggagaaatgtcgcctgctctttgccgcccactgtctgctgtatacacccgaa
aacgagcactttggcattgtgccgctggagggcatgtactgctccaagccagtggtggca
ttgaacagcggtggacccactgaaacggtggtgaacacttcaacgggctttctgtgcgaa
aaaaccgaaaagagctttggaggagcaatgcaccagcttttccgagacgagcagctgcgt
gtgaaaatgggtgaccagggtcacaagcgggtgcagcagaagttctccttccaagcattc
gcagatcggctgaacggcatcattagagatcttgttcctatttccaaggagtcgagtcct
aagaaaactgaataa

DBGET integrated database retrieval system