KEGG   Drosophila erecta: 6543764Help
Entry
6543764           CDS       T01060                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6543764
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     6543764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 6543764
NCBI-ProteinID: XP_001971358
FlyBase: FBgn0106734
UniProt: B3NF42
Position
Unknown
AA seq 441 aa AA seqDB search
MTATKKRLKIVAAISLVLLLLVYLYRLASLFPSGKPPLSVSGGEEVQAKWPPTESPLQRS
LQIAYEEQSSLIREHKAELQRTREHLARLEEQIRSLQSSTPRKYAKVKYLNYKNRKRILI
TGGAGFVGSHLVDNLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFIEI
DEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSEVYGDPTVHP
QPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRMHMNDGRV
VSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNPVEQTIGE
FAEIIKQLVGGPSVIKQSKAMEDDPQRRKPDITRARQFLHWEPKVPLETGLQRTISYFRN
ELARSDRFQESSNKYFDTHTP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccaagaagcgcctgaagatcgtagcagccatctcgctggtcctcctgctc
ctggtctacctctaccgattggccagcctttttccaagcggcaagcccccgctttctgtt
tccggtggcgaggaggtgcaggccaaatggccacccacggagagtccactgcaaaggagc
cttcagatagcctacgaggagcagagctctcttatccgggagcataaggctgaactgcaa
cgcacaagggaacatttggccagattggaggaacaaattcgtagcctccagagcagtact
cctcgcaagtatgcgaaggttaaatatctgaactacaagaatcgcaaacgcatactaatt
accggtggagctggcttcgtgggctcccatctggtcgacaatctgatggtccaggggcac
gaggtcatcgtggtggacaatttctttacgggacgcaagagaaatgtcgaacactggctg
ggtcacgagaacttcgagctcattcatcacgacatagttaatccgcttttcatcgagatc
gatgagatctatcacttggcatcgcctgcctcgccccctcactacatgtacaatccggtg
aagaccatcaagaccaacaccatgggcaccataaatgtactgggcctggccaagcgcgtg
atggccaaggttctgatagccagcacttcggaagtgtacggcgatcccacggtgcatccg
cagccggaaacgtactggggccatgtaaatcctattgggccaagggcctgctacgacgag
ggaaagcgtgtctcggagacgctgagttatgcgtatgctaaacaggagaaggtgcaagtg
cgagtggcgcgtatcttcaacacttatggacccaggatgcacatgaacgatggacgagta
gtgtcgaactttatacttcaggcgctgaggaatgaaaccattacggtatatggaaatggc
aaacaaacgcgctcctttcagtatgtttcggatttggtggatggaatgatagccttaatg
gcatccaactacacacagccagttaatttaggcaatcccgtggagcagacaatcggcgaa
ttcgctgaaatcataaagcaactggtcggcgggcccagtgtgataaagcaatcaaaggcc
atggaggatgatccgcagcgcagaaaaccggacataactcgtgcccggcagttcctccac
tgggagccaaaggttcctctagagactggactccagcggaccatctcctacttccgcaac
gaattggcgcgtagcgatcgctttcaggaaagctctaacaagtactttgatacacataca
ccgtag

DBGET integrated database retrieval system