KEGG   Drosophila erecta: 6543766Help
Entry
6543766           CDS       T01060                                 

Definition
(RefSeq) probable chitinase 2
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6543766
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6543766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 6543766
NCBI-ProteinID: XP_001971194
FlyBase: FBgn0106822
UniProt: B3NEU7
Position
Unknown
AA seq 484 aa AA seqDB search
MTLRGGLSGEAPQLWLLLLLASTAGSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAY
AFDNFDPSLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKV
SLAIGGWNEGSANYSILVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRGGKAADR
ENFVLLTKELREEFDEHGLLLTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWD
QRVGYNAPLSAPADDPLSVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLAGGGLNDVSE
GVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSERNIFTQEINVVTY
DSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTALPKRSSQNYP
LLRTINEATMLAVDELAVPELPPDDSSNEIPHGSIADRKNAGASVVSLGLGATAVFMLLH
RMAQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaggggcggacttagtggggaagcaccgcagctgtggctgctcctcctcctg
gccagcactgcgggcagcttgtgggcttcggtggccgccaggacagggccactgcacgac
aaggtggtggtttgctacgtttccacgtgggctgtgtaccggccggagcagggcgcctat
gccttcgacaacttcgatcccagcctgtgcacccatgtggtgtacgccttcgcgggtctg
gacatcacccaggcagccatcaagtcgttggatccctggcaggacctaaaggaggaatac
ggcaagggtgggtacgagaaaatgacgggcctgaagcgcagccatccgcatctgaaggtg
agcctggcgatcggcggctggaacgagggttcggccaactactccatcctggtggccaac
aatctgctgcgcggcaggttcgtcaagcaggtgtccagtttcatacgcaagtacaacttc
gacgggctggatctggactgggagtaccccacgcagcgggggggaaaggccgcggatcgc
gagaacttcgtcctgctgaccaaggagctgcgcgaggagttcgacgagcacgggctgctg
ctgacctccgccatcggggcgtccaagaaggtcatcgacgaggcctacgacgtgcgccag
atctcgcgctacctggactacctgcacatcatgtgctacgactaccatggcagctgggac
cagagagtgggttacaacgctccgctctcggcgcccgcggatgatccgctgagtgtgaaa
ttctccattgactacctgctgaagctgggcgcgccgccggagaagctggtgatgggcctg
cccttctacggacgcaccttcaagacgttggccggcggaggcctaaacgacgtcagtgaa
ggagtaggcttcaagggaccctacacgcgggaggacggcttcctgggctacaacgagatc
tgccagacgctgagcaaccagacctccggatggacgagggagtgggatccgcaaaccagc
caggtgctggccaagtccgagcggaacatcttcacccaggagatcaacgtggtcacctac
gacagctcccgttccattgccaacaaggtgctgtttgccatgtccaagcggctggcggga
gtgatggtgtggtcggtggacacggacgacttcctgggcaactgcaagctggacgaggac
acgtacgaggacttccagaaggtgactgcgctgcccaagagatcgagccagaactatcca
ctcctgcggaccatcaatgaggccaccatgctcgccgtggacgagctggctgtgccggag
ctgccaccggatgactcctcgaacgagattccgcacggcagcattgcggatcgcaagaat
gccggcgcttctgtggtcagtctgggtctcggagccaccgcagtcttcatgctcctgcac
cggatggcccagtga

KEGG   Drosophila erecta: 6546512Help
Entry
6546512           CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein LOC6546512
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6546512
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6546512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 6546512
NCBI-ProteinID: XP_001971343
FlyBase: FBgn0106742
UniProt: B3NF27
Position
Unknown
AA seq 1013 aa AA seqDB search
MFPPRLLRIAFVICLLIVLLSPSTDSAQTKTRRRLRRPTTSVSSSRSNLIESKKSTEAPE
AEKRIDLITSATTTSARRTRLRSKAKLGAAAAGGAAAAAGATALVASGSSLKGKKTKVDD
GTPKIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNV
PGLYERMMSLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFD
GLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDV
PAIASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPK
EKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYV
WDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVK
YPLIGAMREELLGISRGKEAKDVNWTAVAATFEDIEEKPEPIKISVDEILNKVRKPQAQK
KQRIKSGANAVASNTRPAQVFCYLTSWSAKRPGAGKFQPENIDPKLCTHIVYAFATLQDY
KLTEATDDDPENYESVIALRDNNPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAI
DFLRDYKFNGLDVDWEYPRGAEDRVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPASF
EAIAAGYDVPEISKYLDFINVMTYDFHGQWERTVGHNSPLFALESATGYQKKLTVDYSAR
EWVKQGAPKEKLLIGMPTYGRSFELVNDTQFDIGSPSSGGGKAGKFTNEAGFLSYYEVCS
FLAADNTTLVWDSEQQVPFAYRGNQWVGFDDERSLKTKTEWLKEQGFGGIMVWSIDMDDF
SGRCGSGKYPLLTALNDELKDYKVELEYDGPYESHGPRGAYTTKDPHDVTCAEEDGHISY
HKDWADCTHYYMCEGERKHHMPCPANLVFNPQENVCDWPENVEGCHTPTEAPA
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaccgcgattgctgcgaatcgcatttgtgatatgcctgctgattgtcttgctc
tcgccctccacagacagtgcacagaccaagacacgtcgacgtctgcgtcgtcccacaaca
tcggtcagctcctcgagaagcaacctcatcgaatctaagaagtccactgaggctccagag
gccgaaaagcgtattgacttgatcacttccgctaccaccactagtgctcgtcgtacacgc
cttcgttccaaggcgaaattgggagcagctgcagctggaggagcagccgcagcagctgga
gcaaccgctctggtggccagtggatcctcgctgaagggcaagaagactaaggtggacgat
ggcacgccgaagatcgtgtgctactacaccaactggtcgcagtaccgtgtcaagattggc
aagttcgttccggaagacattccagccgatctctgcacccacattatcttcgcttttgga
tggctgaagaagaacaagctgagttcttatgagtccaacgatgagaccaaggataatgtc
cccggactgtacgaacgtatgatgagccttaaaaaggccaatcccaaactaaagatcctt
cttgctcttggaggttggtcctttggcacccagaaattcaaggacatgtcctccacgcga
tacacccgccagacctttgtctactcggccattcctttcctgcgcaagcggggctttgat
ggtctggatatggattgggaataccccaagggttccgatgacaagaagaacttcgttctg
ctgctgaaggaactgcgcgaagcctttgaagctgaggcccaggaactgaagaagccacgt
ctcctgctttccgccgccgtgcccgtcggtcccgacaacatccgtggtggatatgatgtg
cctgccatcgccagttatctggatttcatcaacctgatggcctacgatttccacggcaag
tgggaacgcgagactggacacaatgccccactttatgccccatccaccgattccgagtgg
cgcaaacaactgtccgtcgacaatgctgccagtttgtgggttaagatgggtgctcccaag
gagaagctggtcatcggaatgccgacctatggacgctccttcactttggctaatccggat
aagcatggtcccaatgcccccgcatcgggtggtggacgcgaaggtgtctataccaaggaa
ggtggtttcctggcctactacgagatctgcgaaatgctgcttaatggcgctgtttatgtc
tgggatgacgagatgaaggttccctacctggttgatggagatcagtgggttggtttcgat
gatgagcgcgccattaggaacaagatgcactggatcaagtcaaatggctttggaggtgcc
atggtctggaccattgacatggacgacttcaagggagaggtgtgcggtggcaatgtcaag
tatccactgattggagctatgcgggaggaactcctcggcatttcacgtggaaaggaggcc
aaggatgttaactggaccgccgttgctgccacatttgaggatatcgaagagaaaccggaa
cccatcaaaatttctgtggatgagattctcaacaaggtgcgcaaaccacaggcccagaag
aagcagcgcatcaagtctggagctaatgctgtcgcctcaaacactcgtcctgcccaggtg
ttctgttacctgaccagctggtcggccaagcgccctggagctggtaaattccagccggag
aacatcgatcccaagctgtgcacccacatcgtgtatgcctttgccactcttcaggactac
aagctaacagaggccaccgatgatgaccccgagaattatgagagtgtgattgctctgcgt
gacaacaatcccgatctgcagatccttctggccatcggaggatgggcctttggttccacg
cccttcaaggagctcacttcgaatgtgttccgtatgaatcagttcgtttacgaggccatc
gactttttgcgcgactataagttcaatggcttggatgtggattgggagtatccccgtggt
gccgaagaccgggttgcctacgtcagtctgctaaaggaactgcgggtggcttttgagggt
gaggccaaatcctctggactgccacgcctactgctcaccgccgctgtacccgcttccttt
gaggccatcgccgctggctacgatgtgccagagatctcgaagtacctggacttcatcaac
gttatgacctacgacttccacgggcaatgggaacgcacagtgggacataattcgcctctg
tttgctttggaatcggccaccgggtaccagaagaaactgaccgttgactacagcgcaagg
gagtgggtgaaacagggagctcccaaggaaaagctgcttatcggcatgcccacctacgga
cgcagtttcgagcttgtcaatgacacccaattcgatattggatccccctcgtccggcggt
ggcaaggcaggcaagttcaccaacgaagccggcttcctcagctactacgaggtctgctcc
ttcctggcggcagacaacaccaccctcgtttgggattcggagcagcaggtgcccttcgct
taccgcggcaaccagtgggtgggcttcgatgatgagcgttctctcaagaccaagacggaa
tggctaaaggagcagggcttcggaggcatcatggtgtggtccatcgatatggacgacttc
tccggtcgctgcggcagtggtaagtacccgctactgactgccttgaacgacgagctgaag
gactacaaggttgagttggaatacgatggtccatatgaatcgcacggcccacgtggagcc
tacaccaccaaagatcctcatgacgtgacctgcgccgaggaggacggacacatcagctac
cacaaggattgggccgactgcacccactactacatgtgcgagggcgagcggaaacaccac
atgccctgtcccgccaacctggtcttcaatccccaggagaacgtctgcgactggccggag
aacgtcgagggatgccacacgcccacggaggcgccagcctaa

KEGG   Drosophila erecta: 6547583Help
Entry
6547583           CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein LOC6547583
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6547583
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6547583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 WSK
Motif
Other DBs
NCBI-GeneID: 6547583
NCBI-ProteinID: XP_001976221
UniProt: B3NNH0
Position
Unknown
AA seq 905 aa AA seqDB search
MKAWIWLSFVACLFAASTEAASNLVCYYDSSSFTREGLGKMLNADLEIALQFCSHLVYGY
AGLRGENLQVHSMNENLDIYKHQYSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDL
LEGEKVRQVGFIRSAYDLVKTYGFDGLDLAYQFPRNKPKKVHGDLGSAWKSFKKLFTGDF
VVDPHSALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLA
TFDFLTPARNPEEADYSAPIYHPDGSKNRLAHLNADFQVEYWLSQGFPANKINLGVATYG
NAWKLTGASGLEGVPVVPDTVGPAPEGLQSQKPGLLSYAEICGKLSNPQNQFLKGNDSPL
RRVSDPTKRFGGIAYRPVDGQITDGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDD
FRGQCSGDKYPILRAIKYRLTANRAEVIPQKSLTAPLWLYLRTKMTGSLWLSLALSLAAL
AQFQVSAAPNLVCFYDSQGFQRQGLAQFSMTDMELALQFCTHLVYGYAGVNADSYEVQSI
NKRLDLEQRHLAQVSSLKERYPHIKFLLSVGGDADTNEGNQYIKLLESGQQGHRRFIESA
RDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHRGQVTA
LVKDLSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEAD
FSAPTYQAVGENRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRAWKLTKDSGDSGMPV
VPSTQGPAPAGPQSKKEGLLNWAEICSLMPNPSNSNARGPNAPVKRVLDPTKRYGSYAFR
AADENGDHGLWISYDDPDSASSKAMYARVKNLGGVALFDLTQDDFRGQCTNDRFPMLRAI
KYRLL
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgtggatctggctttcgtttgtcgcgtgcctctttgcggcaagtacagaagct
gcctccaacctggtctgctactatgactcttccagtttcaccagggaaggtctgggcaag
atgctcaatgccgatctggagatcgccttgcagttctgcagccacttggtctacggatac
gccgggctacgaggagaaaacctgcaggtgcacagtatgaacgagaacctggacatatac
aagcatcagtactccgaagtgacctccctgaagaggaagtatccccacctgaaggtcttg
ctgagcgtgggcggcgatcatgacatcgatccggatcatcccaacaaatatatcgatctg
ctggagggcgagaaggttcgtcaagttggattcatccgctcggcctatgacttggtgaag
acctacggcttcgatggcttggatctggcctatcagttccccaggaacaagcccaagaag
gttcacggtgacctgggctcggcatggaagagtttcaagaaactgttcaccggcgacttt
gttgtggatccacactcagcccttcacaaggaacagtttaccgctttagtgagggatgtc
aaggactccctgagagctgatggattcctgctcagcctgactgtgctgcccaatgtcaac
tccacttggtactttgatattcccgcgctgaatggcttggtggactttgtgaacctggcc
accttcgactttctgactccagctcgcaatcccgaggaggcggactatagcgctcccatc
taccatcccgatgggtcaaagaatcggctggctcacctgaacgccgatttccaggtggag
tactggctgtcgcagggattcccagctaataagatcaatttgggtgttgccacctatggc
aatgcctggaaactcaccggggcctctgggctcgaaggagtacctgtggtgccagataca
gtgggaccagcacccgagggcttgcagtcgcagaaaccaggactacttagctatgctgaa
atctgcggaaagctgtccaatccccaaaaccaattcctcaagggcaacgactcgccactg
cgacgggtttcagatcccaccaagagattcgggggcatagcttatcgccccgtcgatggc
cagataaccgatggcatttgggtgagctacgacgatcccgactcggcctccaataaggcg
gcctacgcccgcgtcaagaacctggggggcgtggcactgttcgatctgagctacgatgat
ttccgtgggcagtgctcaggcgacaagtatcccatcctgcgagccatcaaatatcgtctt
acggcgaatcgcgcggaggtgattccacagaaaagcttaacagctcctctctggctgtat
ctgcgtacaaagatgactggctctctgtggctcagtttggcactcagcttggcggctttg
gctcagttccaagtgagtgccgctcctaatctggtttgcttctatgactcgcagggcttc
cagcgccagggcctggctcagttttcgatgaccgacatggagctggcgctgcagttttgc
acccatttggtctacggctatgcgggtgtcaatgccgatagctatgaagtgcagagcatt
aacaagcgactggacctggagcagcgccacctggcccaagtctccagcctgaaggaacgc
tatccccacatcaagttcctcctgagcgtgggcggggatgccgatacgaacgagggcaac
cagtacataaagctgctggaatcgggacagcagggccacagacgcttcatcgaatccgct
cgggatttggtgaggcgttataatttcgatggcctggacctggctctccaactgcccaga
aataagccacgcaaagttcacggggatgtgggctccgcctggaagagtttcaagaagttc
ttcaccggcgatttcattgtggataccgagtccgaaacgcaccggggacaggtgactgcc
ctggtcaaggatttgagtgctgctctgaagcaaaacgatctgctgctcagcctcaccgtt
ttgccaaatgtgaactcaagctggtactacgatgcgccttcgatcgctccaagcctggac
ttcatcaacctgggaacttttgacttcttgaccccgcagcgcaatcccgaggaggcggac
ttttcggcgcccacataccaggcggttggcgaaaatcgtttgggccactacaatctcaac
ttccaaatggagcactggctgctgcaaagagtgcctgcgaataagataaacattggcatc
gccacctatggcagggcatggaagctgaccaaggattcgggtgactctggcatgcccgtg
gtgccctccacccagggacccgctccagcgggaccacagagcaaaaaggagggtctgctt
aactgggctgagatctgctcgctgatgccgaaccccagtaactcgaatgccagaggtccc
aatgcgccggtgaagagggttctggatcccacaaaacgttatggcagctacgccttccgt
gccgccgacgaaaatggagaccacggcctttggatcagctacgacgatccggactcggcc
tccagcaaggccatgtacgccagggtgaagaatctcggcggagtggctctctttgacctg
acccaagacgatttccgtggtcagtgcacaaacgatcgcttccccatgctgcgtgccatc
aagtaccgtcttctctaa

KEGG   Drosophila erecta: 6547742Help
Entry
6547742           CDS       T01060                                 

Definition
(RefSeq) chitinase-3-like protein 1
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6547742
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6547742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14 Glyco_hydro_114
Motif
Other DBs
NCBI-GeneID: 6547742
NCBI-ProteinID: XP_001974996
FlyBase: FBgn0114256
UniProt: B3NK30
Position
Unknown
AA seq 476 aa AA seqDB search
MWSGSGLVKLLLGAILMAAASSAQGNSSKNVVCYQGTWSVYRPGLGKFGVEDIDPFLCTH
LIYAFLGIEETGQLRVIDAYLDLEENGGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKR
FSLVARDPLKRAKFVDDVVRLLQRHGFDGLDLDWEYPSQRHSLDNDDRSNYITFLRELKE
GLEPFGFLLSAAVGSAQFSAEISYDIPAIVPYLDLINVMAYDLHGPWDKVVGINAPLYAA
ESDASDSTGRQQQLNVDAVVKYWLLSGAPAEKLVLGVPFYGRSFTLATAEGNQPGAPHIG
KGIAGKYSREPGVLGYNELCEMMGQEEWTQKWEVTQQVPYAFKQRQWVGYENPRSLALKA
QYVMDHHLGGIMIWSLESDDFRGTCGQQPYPLLHEINQVLFGGNTPSGLTTESNKNTISE
GFSCPADAPEGYVRDPDNCAKFYYCSGGKTHNFDCPIGLKFDLDTNSCNYSGSVKC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcggatctggtttagttaagctgctcctcggggcaatcctgatggcagcagca
tcatctgcacaaggcaactcttcaaagaacgttgtctgctaccagggcacgtggtccgtt
tatcgacctggtctgggcaagttcggcgtggaggatattgatccgttcttgtgcacccat
cttatttacgccttcctgggcatcgaggagacgggccagcttcgggtgatagacgcttat
ctggatcttgaagagaatggtgggcgcggaaatatcaagagctttaatgccctcaagcta
aagaatccagtattgaagacgctcgtggccgtgggtggttggaacgagggttccaagaga
ttctccttagtggcccgcgatcccttgaagcgtgccaagttcgtggatgatgtggtcagg
ttgctgcagcgccatggtttcgatggcctggatctggattgggagtatcctagccagcgt
cacagtctggataacgacgatcgctcaaactatattactttcttgagggagctgaaagag
ggcttggaaccctttggttttctgctcagtgctgctgtgggctccgcacaattctccgct
gaaatatcgtacgacattccggctattgtcccgtatctggacctcattaatgtgatggcc
tacgacctccacggaccgtgggacaaggtggtgggcatcaatgctcctctgtatgctgct
gaaagtgatgcgagtgattctaccgggcggcaacagcagctgaacgtggacgccgtggtc
aagtattggctgctatcaggtgctccggctgagaagctggtcctaggagttcctttctac
ggacgctcctttactttagccaccgccgagggcaaccagccaggagcgccgcatatcggc
aagggcattgcaggaaaatactcccgcgaaccgggtgtcctgggttacaacgaactctgc
gagatgatgggacaggaggagtggacacagaaatgggaggtcacacagcaggtgccttac
gccttcaagcagcgccagtgggtggggtacgaaaatccacgcagcttggcgctcaaggcg
cagtatgtgatggatcaccacctgggtggcataatgatatggtccctggaatcggacgac
ttccgcggcacatgtggtcagcagccctatcccctgctgcacgaaatcaatcaagtgctc
ttcggcggcaacacgccatctggtttgaccaccgaatcgaacaagaacacgatcagtgaa
ggattcagttgtccagctgatgcgcccgaaggatatgttcgggatccagacaactgcgcc
aagttctactattgcagtggcggcaagacccacaactttgattgtcctattgggctgaag
tttgaccttgacaccaacagctgcaactattctggatcagtaaagtgctag

KEGG   Drosophila erecta: 6547743Help
Entry
6547743           CDS       T01060                                 

Definition
(RefSeq) chitinase-3-like protein 1
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6547743
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6547743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 6547743
NCBI-ProteinID: XP_026835907
FlyBase: FBgn0112995
Position
Unknown
AA seq 470 aa AA seqDB search
MTSFHYVLMVMVLLICGCLAKEYNVFCQYDLASYYYKGRSQFFEWHLDSRLCTHLVLGSG
IGVDGETGQLRITDKILLLEKNKLSSVKTMKWDSIRKVMFTIGGWEEDSSAFSRMVASPK
KRDNFYTSMLDFMSQWGFDGVQIDWRYPTQFGGQSEDRQNFVILLKELGLIFRHHQLILM
VAVLGRTNKRHLESYNIPEIVKNSDFVHLMMHDERDPFRQRLTYNAPLRGNEDSATKSIG
HWKRNGKAPEKLILGIPLFVRSYTMDRNQSAVGSPCKGPGRPTKQTHRSGFMTYNEWCVQ
QSKWNRKFDQVAKVPYATLGDQWVSYENPQSIWAKMHLLEKHKLGGAMAWTIDVDDFRGT
CGESHGLLRVIFSALGDKNALTTEKPTTEAIGMCPHDGFMRNGWDCRLYHECRDGERIYY
ECLEGQYFDEKQVMCRPAAEVKCDQNFVIWRPGMPVYNFKNMPLNLKIVD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttttcactatgttctaatggtaatggtattgctgatctgcggttgtctagca
aaagagtataatgtcttttgtcaatatgatttggcctcctactattacaaaggacgcagc
caattctttgagtggcacttggactccagactgtgcacccacttggtccttggttctgga
ataggtgtggacggggagaccggtcaactgaggatcaccgacaagattctgctacttgag
aagaacaagctgagcagcgtcaaaaccatgaagtgggatagcattaggaaggtgatgttt
accatcggtggttgggaggaggattccagcgcgttctcccggatggtggcctccccaaag
aagcgggacaatttctatacctctatgttggacttcatgtcccagtggggattcgatggc
gtccagatcgattggcgctatcccacacagttcggtggtcagtcggaggatcgccagaac
tttgtgatcctgctaaaggagctgggattaatctttcgacatcaccagctcattttaatg
gtggctgtgctgggacgaaccaacaagcggcacctggaaagctacaatatccccgagata
gtaaagaactctgactttgtccatctgatgatgcacgacgagcgggatccgtttcgtcag
cgcttgacttacaatgctccacttcgtggaaatgaagacagcgcgactaagtccattggg
cattggaaacgaaatggaaaagccccagagaagctgatcttgggcatcccgctcttcgtg
cgctcctacaccatggataggaatcaatcggcagtgggatccccctgcaaaggacctggc
agaccgactaagcaaactcaccgttccggcttcatgacctacaacgagtggtgcgtgcag
cagtccaaatggaacaggaagtttgaccaggtggccaaggtgccctatgccacactgggt
gatcagtgggtgagctacgagaacccgcaaagcatctgggccaagatgcacctgttggag
aagcacaagctgggtggcgccatggcctggaccatagacgtagacgatttccgtggcact
tgtggcgagagtcatggattgcttcgtgtgatcttctccgccttgggcgacaagaacgcc
ctcacaacagagaagccgaccacagaagccatcggaatgtgcccccatgatgggttcatg
cgcaatggttgggattgccgattgtaccatgagtgccgcgatggggagaggatctactat
gagtgcctcgagggtcagtacttcgacgagaaacaggtcatgtgtcgaccagccgctgag
gtcaagtgtgatcagaactttgtcatttggcgaccgggcatgcccgtgtacaacttcaaa
aacatgccactaaaccttaagatcgttgactag

KEGG   Drosophila erecta: 6547744Help
Entry
6547744           CDS       T01060                                 

Definition
(RefSeq) acidic mammalian chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6547744
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6547744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 6547744
NCBI-ProteinID: XP_001974998
FlyBase: FBgn0112994
UniProt: B3NJZ1
Position
Unknown
AA seq 463 aa AA seqDB search
MKLVSIWALVALCLCLGQVATSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHISYTF
FGISDAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKVLAVVGGWNEGSTKYSAMAAD
PAKRATFVSTSLTFIQQHGFDGLDLDWEYPRQRGGSEADRENFVTLLREIKETYDQHGLE
LGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPLPEVTESIDYWL
SHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAASIGPGSAGIYTRENGFLGYHEICLNNW
HTVFDQENGAPYAFQGDQWIGYDNPESIQIKMQLVESRNLGGAMMWSIETDDFRGLCGES
YPLLKTMNRALGKEVSGGGGGSVTPAPTAAPTPAPTPGGGSGGSGGGSSGDCSADGHFHS
VGDCNKYYQCIGGIRYDFQCGEGLYFSTSTYTCDWPQNVDCPY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtctcgatttgggccttggtagctctttgcctttgccttggacaagtggcc
accagcgaaaagctgctgaactgctactggggcacctgggccaactaccgtcccggagat
ggaaagttcacaccctctgatattgacccctccctgtgcacccacatcagctacaccttc
ttcggaatcagcgatgccggcgagttcaagtccctggacacctggctggacatggacgat
ggacttggttttattagtcaaacgattgcgctgaagcagcgcaacccaaacctgaaggtt
ttggcggtggttggtggctggaatgaaggttccaccaagtactcggccatggccgccgat
cctgccaagcgtgccacctttgtctcaacttccctgaccttcattcagcagcacggcttt
gatggattggatttggattgggagtaccctagacagcgaggaggcagtgaagcggatcgc
gagaacttcgttactctgctgcgcgagattaaggaaacctacgaccagcatggattggaa
ctgggtattgccgtcggtgcctcagagaaatcggccagcatatcatacgacattccggcc
atttcgcagcacttgactttcattaacgttatgacctacgacttccacatggctctggat
ggctatctgggtctgaacgctcctctgcccgaggtcaccgaatctattgactactggctt
tcccatggtgcacccgcggagaaacttatcttgggcattggcttctatggccacagctac
cagatgtccgatagctcacagaactggcccggagctgcgtccattggtcccgggtctgct
ggcatctacacccgggaaaatgggttcctgggctaccacgagatctgcctgaacaactgg
cacaccgttttcgatcaggagaacggtgctccatatgctttccagggagatcagtggatc
ggctatgacaatcccgaaagcatccagataaagatgcagctggtcgagtcccgcaatctg
ggtggtgccatgatgtggtccatcgagacggatgatttccgcggcctgtgtggagagtcc
taccccctgctgaagaccatgaaccgagctctgggcaaggaagtgagtggtggaggagga
ggaagtgttactcccgctccaactgccgctcccactccggcacccactcccggtggtgga
agtggtggcagcggaggcggctccagtggagactgctccgcagatggtcactttcactcg
gttggcgactgcaataagtactaccagtgcatcggaggcattcgctacgactttcaatgc
ggggaaggactgtacttcagtacctcaacctacacatgtgactggccgcaaaatgtcgac
tgtccctattaa

KEGG   Drosophila erecta: 6547745Help
Entry
6547745           CDS       T01060                                 

Definition
(RefSeq) acidic mammalian chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6547745
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6547745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 6547745
NCBI-ProteinID: XP_001974999
UniProt: B3NJZ2
Position
Unknown
AA seq 368 aa AA seqDB search
MGKLLALLAVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGI
NDNGDIQSLDTWLDYDLGFISQAISLKQQNSNLKVLAVVGGWNEGSTKYSSMARDWYKRQ
NFINSALNLLRNHGFDGLDLDWEYPNQRGGNWDDRANFVTLLREIKEAFAPYGYELGIAV
GAGESLASASYEIANIAQHVNFINVMTYDFAMASDGQTGFNAPQWAVENAINFWLSQGAP
ANKLVLGVGTYGHSFQLSDSSQNWPGAPCRGEGAAGSYTGSNGYLGYNEICLNNWHTIFD
YGNAAPYAYSGDQWVSYDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQCGETYPLLK
TINRKLRW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagttattggcactactcgcagtcctctgccttagccaggttatcggtgctgaa
cgcatcgtcaactgctactggggcacctgggccaactaccgcagcggcaatggcaagttc
gatgtgtccaacatcgatgctggtctgtgcacccacctgagctactccttcttcggaatc
aacgacaatggtgacatccagtccctggacacctggctggattacgatctgggcttcatc
agtcaggcgattagcctgaagcagcagaactccaacctgaaggtcctggccgtggtcggc
ggctggaacgagggctccaccaagtactcctcgatggcccgcgattggtacaagcgccag
aacttcatcaactccgccctgaacctgctgcgcaaccatggcttcgatggtctggatctg
gactgggagtaccccaaccagcgcggtggcaactgggacgatcgtgctaactttgtcact
ctgctgcgcgagattaaggaggcgttcgctccctatggctatgagctgggtattgcggtg
ggcgccggcgagtcattggccagtgcatcctacgaaattgccaacattgctcagcatgtc
aacttcatcaacgtgatgacctacgactttgccatggcctccgatggccagaccggtttc
aatgccccccagtgggccgtggagaacgccatcaacttctggctgagccagggtgctccg
gccaacaagttggtgctcggcgtgggcacttacggacattccttccagctgtcggactcc
tcccagaactggccgggagcaccgtgccgcggagaaggcgccgctggatcctacactggc
tctaacgggtacctgggctacaacgagatctgcctgaacaactggcacaccatcttcgac
tacggaaatgccgctccctacgcctactccggtgaccagtgggtgagctacgacaacgtg
ctcagtgtccagtacaagatggactttgctctgtccaagggtctggccggcgccatgatc
tggtccttggaaacggatgactaccgcggtcagtgcggtgagacctatccgctgctcaag
accatcaacaggaagctgcgttggtaa

KEGG   Drosophila erecta: 6548607Help
Entry
6548607           CDS       T01060                                 

Definition
(RefSeq) probable chitinase 10
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6548607
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6548607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 6548607
NCBI-ProteinID: XP_026838672
Position
Unknown
AA seq 2308 aa AA seqDB search
MQLNAPCMLVVVLAIAVKAHIRMDKLEVNVESNYKPSFIRSAIESIPLDTDARLLVRNSA
KPEFGDVFLPLRSAVESIPTPYQSNTSKLRQNPDIRSFVRDSIESLPNVEDGLEHMELST
NYSNGVSDDVVGVDLKSKKLTQNVHVDPWSISDKYASFIDSGNLDDIYPKSYRAGSPHQE
LLKMMNVEPVKHVDKLDRYAELQSYGVLGQSNLQQSYGALGLVNRNDFKVTTKVLCYMSN
WAFYRSGEGHFVPEQIDPKLCSAIIYSFASLDPDHLTIREFDSWVDLDNQYYRRVTSLGV
PVLIALGGWTDSSGSKYSRLVSDKLKRRVFASSVSSFLMRHGFSGLHLDWNYPKCWQSDC
SRGPATDRPNLTKLLRELRTEFQGVNPKFQLGVAISGYKEIITEAYDFPALSDIVDYMTV
MTYDYHGAWEQNTGHVSPLYGLSTDTYPQYNTNYTMQLLLKMGARREKLVLSIPFYGQSF
TLAQKQKILVGPGVAATGPGAAGELTKQPGMLAYYEICQRLTKFKWMSDRDLSLKFGPYA
MLNDQWVGYEDPTSAQAKARYAANNNFAGVAAWTVDLDDFRNLCCSESYPLLRAINRELG
RLESKPPAHPNCKRPTLLVTPMPPQMTTISSDGSGGLGQNHGHTTSSLSWEDSSSLMFST
TKNPNLVSTTATSIIPWWSSTTKRPREPTMTTARPTPTTIPVPAVIYPVVQPSNCKSGDF
YADSNNCNAYYHCVTAGELRQQFCPGGLHWNNEAKGCDWPSSARCSHKLDQHLNTSYPKP
IKTSKKPETKPSSVHHQVSNSSSGPQYLRPTILECNEGEYYPHRNCRKYYICVNKALVPS
ECDRGLQWDGIKKLCDWPENVQCVTIQKYFKIIQSSSANEEDPCKGEERVPYPGNCSKYL
FCLWNRLQASDCPPGLHYNEVIGNCDWPSAAKCDPKGGESSGEADMNAMSKPPTSQAPSG
LPRPTYPTEKPVPKPLSSHYKVICYFTNWAWYRKGIGRYTPDDINTDLCTHIIYGFAVLD
HSELILRTHDSWADVENSFYTRVSSLKGKGIKVSLALGGWNDSQGDKYSRLVRSPVARAR
FVRHALEFIEKYGFEGLDLDWEYPVCWQTECHKGSTAEKEGFTAWVQELSDAFRPRGLLL
STAVSPSRKIIDAGYDVQKLSRYFDWIAVMTYDFHGHWDKKTGHVAPLYHHPDDDFEHFN
VNSSINYWIEKGAPSQKLVMGIPLYGQSFTLENINSSGLNAKAPRPGEAGEFTRAAGFLA
YYEICERVNRQGWQVVHDEFDRMGPYAYKGTQWVSYDSPYMVRKKAYLARSLNLGGGMVW
ALDLDDFRNRCGNGVHPLLSEIHKVLKDTPSSLDKPAGLVPIESKPIEYPGVDGMKPESG
GEDTEMQSIESVMQSTNDKDEEHELLEPLHEVDPNNVSEEEHIEASDMSTDFKIVCYFTN
WAWYRQGGGKFLPEDIDADLCTHIIYGFAVLSREKLTIQPHDSWADLDNKFYERIVAYRK
KGVKVTVAIGGWNDSAGDKYSRLVTNPEARSRFVRNILKFIEEYNFDGLDLDWEYPVCWQ
VDCKKGSADERTGFTALVRELFYAFQPKGLILSAAVSPNKKVIDAGYEVAELSYYFSWIS
VMAYDYHGQWDKKTGHVAPMYAHPEGTVNFNANFSMNYWISKGADRRKLVMGMPLYGQSF
SLAETSNHQLNAPTYGGGEAGEATRARGFLAYYEICLKIRHHRWNVVRDTKGRMGPFAYH
GDQWVSFDDAPMIRHKSEYIKAMGLGGAMIWALDLDDFKNVCGCETYPLLKAINRVLRGF
GGPHSKCWLEQRKNTMKPNDDSFRSTINAQPGPNLHSGTQNLSLNVMSIKCRSKNYLPHE
RDCTKYYICDNGTHEERSCPEGLQWNKNFCDWPNNVQCPLRSDQITQKPPIHSSNPTNAI
TEPLTTNNAYKVVCYFTNWAWYRPSQGKYVPEDIDANLCTHIIYSFAVLDSNSLTIETDD
SWTDIDNRFYERVVKYKKRGIRVMLAIGGWNDSMGNKYSRLVLDSQSRKRFVASVISFVE
QYGFEGLDLAWEFPVCWQVDCDKGNPTEKEGFVALVKELSQAFKAKGLILSAAVSPSKMV
IDAGYKVSELSPHFDWLAVMTYDFHGHWVMRTGHASPLFHKVGDADLYLNGNFSIHYWLA
RGIPREKLVMGMPMYGQTFTLADPNRRSLNDKTVGPGKAGTLTRANGFLAYYEICEKVGN
GDWEVVRDEEGIFGTYAYSGNQWISYDDVRTIRRKAQFIKSLQLGGGMIWALDLDDFRGI
CGCGKHPLLRTLNQELLGLPGQKAKDCT
NT seq 6927 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcaatgccccgtgtatgcttgtggtagtcttggcaatagccgtaaaagcccac
attcgcatggataaactggaggtcaatgttgaatcgaactacaagccttcattcattcgt
tctgcgatagagagcattcctttggatactgacgccagactcctagtccgtaacagtgca
aaacctgagtttggggacgtttttctaccgctgcggagtgctgtggagagtattccaacg
ccttatcaaagcaacacgtctaagctgaggcagaaccctgatatacgttcctttgtacgt
gattctatagagtcattgccaaatgttgaagatggactggaacacatggagctttccaca
aattattctaatggtgttagcgatgatgttgtaggtgtagacctgaaaagcaaaaagtta
acacaaaatgtacatgtagatccctggagcatttccgataagtacgcttcatttattgac
tccggaaacttagacgacatttatccgaagtcataccgagccggctcaccgcatcaggag
ttgctcaaaatgatgaacgtcgaaccggttaagcacgtcgataaacttgataggtacgca
gagctgcagtcttacggtgtattaggacaaagtaaccttcagcagtcctatggagctttg
ggattggtgaacaggaatgacttcaaagtgactacaaaagttctttgttacatgtcgaac
tgggcattttatcgaagtggcgaaggtcattttgtccctgagcagattgaccctaaactc
tgttctgctattatctattcgtttgcctccttagatcccgatcaccttaccattcgagaa
ttcgattcatgggtggacttggataaccaatattaccgtcgggtgacatcgctgggagtg
ccagtactaatagccttgggtggatggacggactccagcggctccaagtactcacgctta
gttagtgacaaacttaaacgacgtgtttttgcatccagtgtgagcagctttttaatgcgt
catggattcagcgggctgcacttagactggaactacccaaagtgctggcagagcgattgc
tcaaggggacctgcgaccgacaggccaaatctgaccaagcttctgcgtgagctgcgcacc
gagtttcagggtgttaatccgaaatttcagttgggagtagccatctctggatacaaggag
attataacagaggcttatgattttcccgctttgtcagacattgtagactatatgacagta
atgacctatgattaccacggagcctgggaacagaacacaggtcatgtgagtccactttac
ggcttatcaacggacacgtatccgcagtacaatacaaactacaccatgcagttactccta
aaaatgggcgcgcgcagggaaaaacttgtattgagcattccgttttacggccagagtttc
acattggcacaaaagcagaaaattcttgtaggcccaggcgtggcagctactggacctgga
gcggccggtgaattgacaaagcagccaggaatgctagcttactacgagatttgtcagcgc
ctaacaaagttcaagtggatgagtgatcgggatttaagcctgaaattcggtccttatgct
atgctaaacgaccagtgggtgggatatgaagatccgaccagtgcccaagcaaaggctcga
tatgcggctaacaataactttgccggagtggcagcgtggaccgttgaccttgatgacttc
cgaaacctatgttgtagtgaatcttatcctttacttagggccattaacagagaattgggt
cgcttggagtcaaagccaccagctcatccaaactgtaagcgtcctacattattggtcact
ccgatgccgccccaaatgacaacaattagtagcgatggttctgggggattgggacaaaat
cacggtcatacaacttcttcgctgagctgggaggacagcagtagcctcatgttcagcact
acaaaaaatccgaatcttgtaagcaccactgctactagcatcatcccctggtggagctca
actacgaaacgtccccgcgagccgactatgactacggcacgaccaactccaaccacaatt
cccgttccagcagtgatctacccagtggtacagccctcgaattgcaaaagcggcgacttc
tacgctgactcaaataattgcaacgcttactatcactgtgttactgcgggagagttgcgg
caacagttttgtccaggcggtcttcactggaacaacgaggcaaagggatgtgactggccg
tcgtccgcccgatgctcacataaactcgatcaacacctaaacacttcttatccaaaacca
attaaaacgtctaaaaagccggagacaaaaccgtcttctgtgcatcatcaggtcagtaac
tcttcaagcggaccacaatatttgcgtccaactatattggagtgcaatgaaggggagtac
tacccccacagaaactgcaggaaatactacatctgcgttaataaggcactggtacccagt
gaatgtgacagaggcttgcagtgggacggcatcaaaaagctttgtgactggcctgagaac
gttcagtgtgtaacaatccaaaaatattttaaaataatccaatcgagtagcgccaacgaa
gaggacccttgcaaaggcgaagagcgagtaccctatccgggaaactgttcaaaatatctc
ttctgcctatggaatcgcctacaggctagtgactgtccaccggggcttcactacaatgaa
gtaattgggaactgtgactggccttcagctgcgaaatgcgatccaaaaggaggtgagagc
agcggagaggcagatatgaacgctatgtcgaagcctcctacttcacaagccccgagtggt
cttccgcgtccaacgtaccccacagaaaaacccgtgcctaaacctcttagtagccactac
aaagttatttgctactttacgaactgggcctggtaccgcaagggaataggtcgctatact
cctgatgacataaacacggatctgtgcactcatataatttatgggtttgcagtgttagac
cattccgaactaatactacgaacacatgattcttgggccgatgttgaaaacagcttttat
acgagggtcagcagcctcaaaggcaagggcattaaggtcagcttagcacttggtggatgg
aacgattcgcaaggcgataagtacagccgcctagttcgaagtccagtggcccgggctcgt
tttgtgcgccacgccctggagttcattgaaaaatacggcttcgagggccttgatttagac
tgggagtacccagtgtgctggcaaacggagtgccacaagggctctaccgcggaaaaggag
ggttttactgcttgggtacaggagctatctgatgcgtttcgccctcgaggacttttgttg
tccactgcagtctctcctagcaggaaaatcattgatgccggatacgacgttcaaaagctc
tcacgctattttgattggatcgctgtgatgacatatgatttccatgggcactgggataag
aaaacagggcatgtggcacctctgtatcatcatcccgatgatgactttgaacattttaac
gtgaactcttccataaactattggatagaaaaaggagcaccatcacaaaaattagtaatg
ggtattccgctatatggccagtcgttcactttggaaaacattaacagcagtggcttaaat
gccaaagccccaagaccaggtgaagctggagaattcaccagagcagctggctttcttgct
tactatgagatttgcgaacgagttaatcgacaaggctggcaggtagtgcatgatgaattt
gatcgcatgggaccttatgcttacaagggaactcagtgggtgtcctacgatagcccatat
atggtccggaaaaaggcatatctggcgaggtcattgaacctgggcggcggaatggtgtgg
gccctcgatctggatgactttcgcaatcggtgtggaaatggcgtacatcctctgctaagt
gaaattcataaagtgcttaaggatactcctagttcattggataaaccggctggtctagtt
cctattgaatcgaaacctatagagtacccaggcgtggatggaatgaaacctgagtctgga
ggagaggatacggagatgcagtccattgaatcagtgatgcagtccaccaatgataaagat
gaagaacatgaactcttagagcctctacatgaagtcgacccaaacaacgttagtgaggag
gagcacatagaagcttctgatatgtctacggattttaagatcgtttgctactttaccaac
tgggcgtggtaccgccaaggtggtggtaagttcctgccggaggatattgatgcagatctg
tgcactcacataatttatggcttcgccgtgttgagtcgggaaaagctgacgattcaacct
catgactcttgggctgacttagataacaaattttatgagcgcattgtagcctaccgaaaa
aaaggcgttaaggtaactgtggcaattggcggttggaatgattctgctggcgataagtac
tcccgactagtaacgaatccagaggcaagatctcggttcgtccgaaatatcctgaaattt
atagaggaatataatttcgacgggttggatctggattgggagtatcccgtttgctggcaa
gtggattgcaaaaaagggagtgcagacgagaggactggattcacagctttggtgcgggag
cttttttatgccttccagcccaaggggttaattctgtcggctgccgtgtcccctaacaag
aaggtcatcgatgctggatacgaagttgcagagctttcttattacttttcttggatatct
gtgatggcgtatgattaccatggtcagtgggataagaagactggtcacgtagctccaatg
tacgcccaccctgaaggaacagtaaattttaacgccaatttttcgatgaactactggata
tcgaagggagctgacaggcgaaagttagtaatgggaatgcctttatacggccagtcattc
tctctggctgagactagtaaccaccaattaaatgctcccacctatggcggtggtgaagct
ggagaggctacaagagccagaggatttttggcatactatgaaatatgtttaaaaatccga
catcataggtggaacgttgtcagggataccaagggacgtatgggacccttcgcatatcat
ggggatcagtgggtttccttcgatgatgcacccatgatccggcataaaagcgagtacatc
aaggcaatgggtctaggtggagctatgatatgggccctagatttggacgacttcaaaaat
gtctgcggatgcgaaacatatcccttgctaaaagctataaatcgcgttctcagaggtttc
gggggtccacattcaaagtgttggcttgaacaacgcaaaaacacaatgaagccaaacgac
gactccttcaggtccaccataaatgcacaacctggaccaaatcttcattctggtacgcaa
aatttatccttaaatgttatgtccatcaaatgccgcagcaaaaactatttgcctcacgaa
cgcgattgcactaagtactatatatgcgacaatggaacgcacgaggagcgaagctgccct
gaaggacttcaatggaataaaaacttctgcgactggcctaacaatgtccaatgcccgttg
cgatcggaccagataactcagaagccaccgatccatagctccaatcctacaaacgccatc
acagagcccctaactaccaataatgcatacaaagtagtctgttactttacgaactgggca
tggtaccgcccatcccagggcaagtatgtgcctgaagatatagacgcaaacttgtgcacc
cacatcatatacagcttcgcggtgctcgatagcaactcgttaaccattgagacggatgac
tcctggacggatattgacaaccgtttttatgagcgggttgtaaaatacaaaaaaagaggt
attcgagtcatgttagccatcggtgggtggaatgactctatgggcaacaagtactcgcgc
cttgtactcgattcacagtccaggaagcgctttgtagcaagtgtgataagttttgtagaa
caatacggttttgagggtcttgacctcgcctgggaattcccagtgtgttggcaagtggac
tgtgacaaaggtaatcccacggaaaaggaaggatttgttgctcttgtcaaggaactgtcg
caagcctttaaggcaaaaggccttattctttcggcagcagtctcgcccagtaaaatggtt
attgatgccggatacaaagtgtctgaactctctccacactttgactggctggccgtcatg
acatacgactttcacggtcattgggttatgcggacgggccatgcatccccgctcttccac
aaagtgggtgacgcagacctatatcttaacggaaacttcagtattcactattggttggca
cgaggtattcctagggaaaagctggttatgggaatgccaatgtacggtcagacgttcacg
ttggctgacccaaatcgccggtcactaaatgataaaacagtgggtccggggaaggcagga
accttaactcgagcaaatggatttttagcatactatgaaatctgcgaaaaggtcggcaac
ggtgactgggaagtggtgagggatgaagaaggaatattcggaacctatgcatacagtggc
aaccagtggatatcatacgatgatgtaagaactattcgaagaaaagctcagtttattaag
agcttgcagctaggtggtggcatgatttgggctctcgatttagacgactttcgtggaatt
tgtggctgcggcaagcacccattacttcggactcttaatcaggagctgctaggacttcct
ggacaaaaagctaaggactgcacttaa

KEGG   Drosophila erecta: 6551453Help
Entry
6551453           CDS       T01060                                 

Definition
(RefSeq) serine-rich adhesin for platelets isoform X8
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6551453
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6551453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 6551453
NCBI-ProteinID: XP_001977278
FlyBase: FBgn0110553
UniProt: B3NW72
Position
Unknown
AA seq 4623 aa AA seqDB search
MLPFRRGAAWQTLFLLCALAYCINEASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCT
HLVYAFGGFTKDNQMKPFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSP
LVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFE
REAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAP
LYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPS
EGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANIMGPYAYRRNQWVGYDDEAIV
RKKAEYVVAQGLGGIMFWAIDNDDFRGTCTGKPYPLIEAAKEAMVEALGLGINEVAKPSG
PQKPSRSRSRDNVNTRNRLNGKTEGPPSTRRPSATRRPAVSSTQAPPPSTTFKLTEAEGS
SLYIGGRASTTPPPPTTPDPGSDFKCEEEGFFQHPRDCKKYYWCLDSGPSGLGIVAHMFT
CPSGLYFNPAADSCDFARNVPCKTKKSTTAAPVTSTTPTTTTVRSNRVTAAPTARPVYPR
ITTTTSTTTTTTTTPATVDEDLEYEEDTDELSPSKSTDAEEDPQVIKELIDLIRKVGGVE
QLEKHLLRNKDGSITLKENSATGAATTPSTISKSLYDRVLSRPGTLSSFSRNRFKISDAT
ETTTAAAASSSSSRGQSTLTSNSNSKYSSVLRGNSRQGPQNEGIEKLAEFDGFLKERKQY
VTINRHRSANQEDEEEHADQQEEEENLAEVQTTTRRPLSSITPSYTSLRRSRPTTVAPPA
EESHVEAEQHTQTQVKSYATLSRTRGRTTASPEVTEAAPSSTTNRYKYFERTRPTKSATA
EDSEDPTEDEEEEYEDEQKDIVTVQSKQSTNTRKYASIGRRTTTTTTATPETTTTTAGTE
TAKASTTTTNNNNNNHYNSSNNNNNVKLNNQIPTEENTSTTPSTTAQSETTTTTNETTEP
NESTSTTTTSITNNLHTITTTTPTPTPIVASTVPTTTANGISSDSLLATELSEASATHLP
PTPDLETSTPTTTSTTTTEPELDTTTTTPKTPTTTTTTTGNIELNDVNNVDEDSEVTKTK
TQYKYATSNRRRITTTTTTTTQNSDNNNNNNAEAANDASPTTNGLSSLNSIRTNPGRRQP
QSEQTQTTTSEPNLSSPRPFGYPRRRTRPTASTTTTTIPQSDNDNNTDNNDNETNAVAQV
VKKTRLSPGDRPKVSASLPTATAINTRTKTSLLHHQESQVEVAGNGGNDSLRHDVVSSSL
SQTQSNKINTDDPSSTYQHTKYIWRGVRRPTTQRTVVPNSLAGDDKDSRRFAGKQLSTES
IVEDELQTTTKFRSRRLNSAEDESEVAFEVATATPSYASRSYQSIQRSASGASIDDSQIR
YKAITRDSEGGAYLTAGRSSSFVRNVGEAAKPTPPHQPISRGGQIVESTTEDENVAAEII
DDEKRGETKAPARSENTDDSNTATEQESPEIVTEAVLPQLEITTLPSETSDVSSSSEESV
SSTTEENASSAAELNTVVEEANDHLGAETDKQLTPENDNSESSTEISSSEAPVSSTTVQS
EDTATNSAAGEKEIDLNISAESSEAPASSTEYLEISTTTSTPVILQEVSSTTTGNPNRRP
INRFGSSTPAAVPEEETTSTVNPRRRVIVRTRTSTTEAEIEAQSTTEGPKRRSFYRTSTV
VAPSGSTEADSEAQLSTEGATRRSFFRTRTTEAASSTTEEPSSTTEEPSSPTEPELEVET
TTEGPTRRSFFRSSTTAAPSSSTTEEISSSSVGDDVKVNTITTRRSLFSKTEPSATEATI
TAEDSDVSSSTRRSFFRTSTTTEGTPSTTEESETSTALPKRRVIVRGNLRARKEGDLSSL
LAADANKRVRNNHSTTSTETTDSQTTTSNEEDTEAQQPQAEEKATTTGRASLNAVRNRTT
TKTESLGNGITRTRTTYVRTLGAGQKVVKRIHTKTIEEKPAEYEYIIDEVTHPPPPSTTP
RTVTRNRGSVRFQSNDLSSLLALDFASRNNRKKQAQTETTVTKTRRRLLKKPKETIEHEE
VEEFEYEAGQEDGNEVEEAPRASTTARTIIRRTRPTTTRTTTETPQSIEASTRRASFAFR
RPSRVSTTTEEPATTSTEPTTSSDATTRRVLTFRRPVSTTTVSSPQSTEDESTEEAAPVE
ATTRRVLAFKRPVSTTTTPAPIEEASTEESIPTSIESTTRRILAFRRPVSTTTTAPVSVE
DESSNDQLAAAKQKFLNRLQSSTTTTTSTPETTTTEEDLSDLKVQLSNAINRLQTENKLE
VQTITMGSETTEDEGDDKLSLPIYHRRKYYQYVKDSPITYIDKSPAPPDIESVTVNIKQQ
IHDVFNVSENETPHNSLVDDEETEGHREAMAQAKEINAELGHFLLKTPGSKTKSQRQGKA
FKTIPLATDSSNETSKIVSLSLLEEKERGDDEARALRTYTRLNRTRLTLSTRLQEKTPSE
PLDTTTRRSYSVPQRFRVRSTTPIPSNTEDSEEDDGATKDIEGPSPSSTTVTPSIKIPTR
RLFTPRRPVSAVEDSDSSDIGNDNEEELKVESTTRRLYAGLNRLRGRGSTTTTTEEATDS
TTEAATTTSKSTRQPYVGISRRVTTTTTTEKPAESSTEYNASEDEETESTTLTPEQEVND
DVEGNKVAIKETEDPIGEQAPEEAEDDTTEEPELEAYIDDDNEIPQEESGPRTETTSTST
TTTTSAPASTTSRRQLVIRRRFNSTITTTTTVAPDADDNLANEIDPNDTESSTPKTATTT
PSRRQLLIRRRFNATNGPTTTTTANPSADNEIDQGEPKSTTRRTILSRRRFNPTSSTATT
PGSTNADEISTRRPYAALNRSRNRFTTPQTTTTDGGEDGDEDDDEDEDEEEEQPAPPRAV
FLQTNRHRALKPTPDEEEDAAAAVPARKPPNYAARRTTAAPLRVSSSTRRNLVAINRNLY
HRAEEIDEEQAEEEYDENEDGNDDEDQEESIDPQVTSTTARSRLSQLLANRQRQPLRTTT
QRQNTDTETDSDNGDENDEEDNDSSAEVSNSNRTLNHSNTLGGGTTNLNNLTNRSTALNV
ASQRSNSTVANYINRFKSNSYTNRIKPVTVTANIKADSTDKDNDNDNDGDDDDDNDGNDD
DNDASLENEGEEKTSGAGLNALGNDVNSTRRFQNRYQLSRTRGSTTNTTPTTTQQAQTTT
TARRLTFGGRQRAQVTKLTLVDEQTEETETKGDAREEDKEEEEEEDSNATTTTTTTTTTS
RPTPKRIRVLKFRRPLNSNSNSTTNVDSTTNSATDTNPDTITATPTTAGQSTTTSNNDTT
STTGNKRFRKIVRKLRPVDSSTAASVDNSDETTRKPFVPSHTRFADHENDLVNLRQRIKE
QQARGEPQDGVISNRYKTLGQKDDQDVSDLQKLRDKVKAEQARGEGEQGVINDRLKKLLA
EKGSSTSSQREESSTDSDSSSVSSARPFFKRKLVARRPYTPPSATGGTTKAPLTFSTTRP
TAKFVRRKNGRFDPFNSSVRNRGEGFVRSDPRGSRLPGADRFKSQGNSEDDEEVEERHEQ
PLQNQFATTLRRPFVPKTRPVLEKSKPQEEDEAEDSEEEDEEEDSEEDGDEEEDEEEEEE
KPEGEEESAQEDNKPKISSSYKPKDNRAPPGSRPTFGTTGSGSPPTASGNVPFNPRNRPS
SSANASNTPTNRFGTTKRPRVVNRPPGVASPNLTLKPVASDYERTTPLTPLKPAPFIPSN
NRSYERKYSGPSTEAAETASENSLIEDLNIDALNARNKKIFDKHSKKHPALKPKVVKVES
ETGLEVETGTEVAVEEETTEEEQQEQGFVTTTPSTPPPPPSPAPPSTQSDTATTTDTPPE
TETETETETETETETETETETENVTETETATNANEATSINSQDQTISSTTQATPPATTLL
HVFTLLEGEGQEEEPTTRRPTVRLYPTIQTEVVPKHKVVEINRIVEINSKQAKAAQRKSK
ANNDFGILMVESLPHVEQLGEISVVKYVHLVDGSDIQINDGHSTVADYTPTEPTSAAQSP
ASLPVRNSLPETEGGDTDRSGKSLVPEVLTAALETSTISLEGLFDSARKGKQLSSNTIIG
ETEESTTIGSSSSSATETGETTTPAPTYLRQPTTGSVSRRPVLSVRRRIINSPTSAAIET
TTQQPAAEPPTTSKYNRLRSRPSAAAAAAAATTTTAAATTAFPAATSAPGGRTTSNIYLS
KLKAKSGAAAAAAAASGEAATLQPATSNISSSSGSNDITQKQHKFQPASFALRRQFQTRR
LTTFAPAANGEESATEVPRTQNPLFKRRLTLISTTPPSARTTNPPVSGLETTTTLYLNDD
DEDQVAKSSIHTSRFNQIPEQVRPRDEYDLALPPQPLKSTIASTTASTTAGTTASTTVNL
PLPVIGQGIRRQLIPRPRRPQSTTSTPPTTSTLGSSLRSTTPAGHSAPPLSRRQQSRRRP
HKYIEVYSRPPAKSAVISATSSSQFLDEEFSVGQSQVAQRRRSGSILPTKSDPKVIVHGH
GIIECRAQGNFPHPLNCRKFISCARFEETGGIVGWEYTCPKGLTYDGVGGMCTWSPSDQP
CRD
NT seq 13872 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgttccggcgtggagcggcctggcaaacgctcttcctgctctgcgctctcgcc
tattgcataaatgaagccagcagcgagggtcgcgtggtctgctactatacaaactggagt
gtctatcggccaggcacggccaaattcaatccgcagaacataaatccatacctgtgtaca
catttggtgtacgcgttcggtggattcaccaaggataaccaaatgaagccctttgacaag
taccaggacatcgagcagggtggctatgccaagttcactggactcaaaacgtacaacaaa
cagctgaagaccatgattgccattggcggatggaacgaggcgagttccagattctcacca
ttggtcgcgagtaacgagcgtcggcagcaattcatcaagaacatcctgaaattcctgcga
cagaaccatttcgatggcatcgatctggactgggagtatccagcccatcgagagggcggc
aagtcccgggatcgtgataactatgcccagtttgtccaggagctgagggccgaattcgaa
agggaagcggagaagaccggacgcactcgtctcctgttgaccatggcagtgcctgctggc
atcgagtacattgacaagggttacgacgtgcccaagttgaacaagtatctggattggttc
aatgtgctgacctacgatttccactcctcccacgagccatcggttaaccatcatgcaccg
ctctattcgctggaggaggactccgagtacaactacgatgccgagttgaatattgactac
tccatcaaatactatctgaaagcgggtgcagatcgggacaagcttgttctgggcataccc
acctatggccgatcctatactttgatcaacgaggagagcaccgaactgggagcaccttca
gagggtccgggagaacagggtgatgccaccagggagaagggatacctggcttactatgag
atctgccagaccctcaaggacgaccccgagtggactgtggtgcagccgaatgccaatatt
atgggtccctatgcctacaggcgcaatcagtgggtgggctacgatgacgaggccatcgtg
cgcaagaaggccgagtatgtggtggcccagggactgggtggcattatgttctgggccatc
gacaacgatgatttccgcggcacctgcaccggaaagccatatcctcttatcgaggctgcc
aaggaagccatggtggaggcattgggtctgggcatcaacgaggtggccaagccaagtgga
ccacagaagccatctagatctcgcagtcgcgataatgtcaacaccaggaaccgtctgaat
ggcaagaccgaaggtccacccagcaccaggagacccagtgccacaagaagaccagctgtg
agctccacccaggcaccgccgccaagcacaaccttcaagctgaccgaagccgagggatcc
tcgctttacattggcggcagggcgtccacaacgcccccaccaccaacgactcccgatcca
ggttcggacttcaagtgcgaggaggagggcttcttccagcatccaagggattgcaagaag
tactactggtgtctggatagcggaccgtctggtctgggaattgtggctcacatgttcact
tgtccatcgggactttactttaatcccgctgccgattcgtgcgactttgctcgcaatgtg
ccctgcaagaccaaaaaatccacaacggcggcaccagtgacctccacgaccccgacaacc
accacagtgcgttccaatcgagtgaccgctgctcccacagctcgtccggtatatccacga
atcaccaccacaacaagcactacgaccaccacgacgactactccagccactgttgatgaa
gatctggaatatgaagaggataccgacgagctgtcgccaagcaaatccaccgatgctgag
gaggatccacaggtgatcaaggaactgatcgatttgattcgcaaagtgggtggtgtggag
cagctggagaagcatcttttgcgtaacaaggatggttcgattacattgaaggaaaattct
gccactggtgcagccactactccgtcaactataagcaaatctctgtatgatcgtgtgctg
agtcgaccaggaacattgagctccttcagccgcaatcggttcaagatcagcgatgccacg
gaaacaaccactgcagccgcagcttcgagcagttcgtcaaggggtcaatcgactctcacc
tccaacagcaattccaaatactcatctgttctgcggggcaacagtcgccaaggtccacag
aacgagggcattgaaaaattggcagagttcgatggttttctgaaggaacgcaaacaatat
gtgaccattaatcgccatcgatctgcgaatcaggaagatgaggaggagcatgcagatcag
caggaagaggaggagaatctggccgaagttcagacaaccacacgtcgtcctttgagctcc
atcactccgtcttacacaagtctcagacgctcaaggcccaccacggtggcgccgccagca
gaagaatcccacgtagaggcagagcaacatacccagacacaggtgaaatcctatgccacc
ttgagtcgcactcgtggacgaaccacggcatcaccagaggtcacggaagcggcgcccagt
tcgacaaccaatcggtacaaatacttcgagcgtacacgacccactaagagtgccactgcc
gaagattccgaagatccaacagaagacgaagaggaagagtacgaggacgagcaaaaggat
attgtaacggtacagagcaaacaatccacaaacacacgtaaatatgcgagcatcggccgc
agaacaaccaccaccacaacagcaacaccagaaactacaacaacaaccgccggcactgag
actgccaaggccagcaccaccaccaccaacaacaacaacaacaaccactacaacagcagc
aataacaacaacaatgtgaaactgaataaccaaataccaactgaagagaacacctcaaca
acacccagcaccaccgcccaatccgaaaccaccaccacaactaacgaaaccactgaacca
aatgaaagcacctcaaccaccaccacgtccataactaataacctgcataccattaccacc
accacacccacacccacaccgattgtagcatccactgtcccaacaacaaccgccaatggc
attagctcagactctctgctagccaccgagttgagtgaagcctcagccacccaccttcct
cccactcctgacttagaaacatcaacaccgacaacaaccagcacaacaacaacggaaccc
gaactggacaccacaacaacgacaccgaaaacaccaacaacaacaacaaccaccacgggc
aacatcgaactgaatgacgttaacaacgtggacgaggacagcgaggtaacgaaaaccaag
acccaatacaagtatgcaaccagcaaccgtcgacgcataaccacaacaacaaccaccacc
acccagaacagcgacaacaacaacaacaacaatgcagaagctgcgaacgatgctagtcca
acaacaaacggtttgagtagtttaaatagcattagaaccaacccgggcagaaggcaaccc
caatcagagcagacccaaacaacaacctccgaaccaaacctttctagtcccagacccttt
ggttatccccgacgtcgcacacgacccacagctagcaccacaaccaccactattccccaa
tctgataatgataacaataccgataataacgataacgaaaccaatgcagttgcgcaagta
gtgaagaagacacgactatctccaggggataggcccaaggtgagtgccagtcttccaaca
gcaaccgcaatcaatacacgaaccaaaacctccctactgcaccaccaagaatcccaagta
gaagtagctggtaacggtggcaatgatagcttaaggcatgatgtagttagctctagttta
agtcaaacccaatccaacaaaatcaataccgacgaccccagtagcacctaccagcatacc
aagtatatttggcgtggggtgcggcgtcctacaacgcagcgcacagtggttcccaattct
ttagcgggagacgacaaggactcccgacgctttgccggcaagcagttgagcaccgaatcg
attgtggaagacgagcttcaaaccaccaccaagttccgcagtcgccgcctaaattccgcc
gaagatgagtccgaggtggcttttgaggtggcaacagctacgccatcgtatgcttcccgc
agctaccaaagcatccaacgctccgctagtggagcgagcatagacgactctcaaatccgc
tacaaagccatcactcgcgattccgaaggcggtgcttatctcaccgcaggacgcagttcc
agctttgtgaggaatgtcggcgaagcagccaaaccaactccgccgcaccaacctattagc
agaggtggacagattgtggagagcaccaccgaagatgaaaatgtggccgctgaaataatc
gacgatgaaaagagaggggagacgaaggcacctgccagaagcgagaatactgatgacagc
aacacggcaaccgaacaggaatctcccgaaattgtaactgaagctgtactaccacagctt
gagattaccactttgccatcagaaacttcagatgtcagcagttcttcggaagaatctgta
agcagcaccactgaagaaaacgccagcagcgccgcagaattgaatactgtcgttgaagaa
gccaacgaccatctgggcgcagaaaccgacaagcagttaactccagagaatgataacagc
gaatcatccacggaaatcagttcttctgaagccccagttagcagcactactgtacaatct
gaagacactgcaactaattcagcagccggtgaaaaggaaattgacctgaatatcagcgct
gaatccagtgaagcacctgcaagcagtacagaatatctagaaatcagtaccacaactagc
accccagtcattctccaagaagtttcttcgacaacaacaggaaaccccaatcgtcgtcca
attaatcgctttggctcaagcactcctgcagctgtgccagaagaggaaacaacttccacc
gtaaacccaagacgtcgagttatcgtgcgcaccagaaccagcaccactgaagcagaaatc
gaggctcagtcaaccacagaaggaccaaaacgacgcagtttttacagaaccagcaccgtt
gtggcaccaagcggctccactgaagcagacagtgaagcccagctatctaccgaaggtgca
acacgtcgttctttctttagaactaggaccactgaagcagctagcagcaccactgaagaa
cctagcagcaccactgaagaacctagcagccccacagagccagaactggaagtcgagaca
accactgaggggccaacgcgtcgttcgttcttcagaagtagcaccactgcggctcctagt
agtagtaccactgaagaaatcagtagcagctccgtaggtgatgatgttaaagtgaataca
atcaccacacgtcgttcgctcttcagcaagacggaaccaagcgcgacagaagccacaata
actgcagaagactccgatgttagtagctccaccaggcgtagtttcttccgtaccagcact
accacagaaggcacaccaagtactacagaagagagtgagactagcactgccttgccaaaa
cgtcgagtgatagtcagaggcaatttgagggcacgcaaggagggagatctctcctctctt
ctagcggcagatgccaacaagcgggtcagaaacaaccacagcaccacgagcacagaaaca
actgacagtcaaacaactacgtccaatgaagaagatacagaggcacaacaaccgcaagct
gaggagaaggcaaccactactggtcgggcttccttaaatgccgttcgaaaccgcaccacc
acaaaaaccgaaagcttaggcaatggaatcacccgcactcgcaccacctacgtccgcact
ctcggcgctggtcaaaaggttgtgaaacgcattcacaccaaaacaatagaggagaaaccc
gcggagtatgagtacattatcgatgaagtgacccacccaccaccgccgagcaccacgcct
cgcacagtgacccgcaatcgcggttccgtgcgcttccagagcaatgatctttcttcgctg
ctggccttagactttgcctcacgcaacaatcgcaagaaacaggcgcaaacagagacaacg
gttaccaagacgcgcagacgcctgcttaagaaacccaaggaaaccatcgagcacgaagag
gtggaagaattcgagtatgaagcaggtcaagaagacgggaatgaagttgaggaggcgcca
cgcgcgagcactacagccaggactataatccgaagaactagaccgacaactaccagaacc
actacggaaactccacaaagtatcgaggctagcacccgcagggcaagtttcgctttcagg
cgtccctctagagttagcacaaccactgaggaaccagctacaacctctactgagcccacg
acatcatcagatgctaccacaaggagagttctcaccttcagaagaccagtgagcacaaca
acagtgagctcaccacaatcaacagaagatgagtctactgaagaggctgcccctgttgaa
gctaccaccagaagagttcttgcgtttaaaagacccgtcagcacaacaaccaccccagct
ccaatagaagaagcgtccaccgaagaatccatccccacttccatagaaagcaccaccaga
agaattctcgctttcagaaggcccgtgagcacaacaactaccgcaccagtctctgttgaa
gatgagtcttcaaacgatcagttagcagcggccaagcaaaagtttttaaatcgcctgcaa
tccagcaccaccacgacaacatccacccctgaaacaacgaccaccgaagaagacttaagc
gatcttaaagttcagctgagcaatgccataaaccgtttgcaaacggagaataaactagaa
gtccagactatcaccatgggaagtgaaaccacagaagatgaaggcgatgataagctttct
ttgcccatttatcacagaagaaagtactatcagtatgtaaaggattcaccaattacctat
atcgacaagtcgcccgcaccaccggatattgaaagtgtgactgtgaacattaagcaacaa
attcatgatgtgttcaacgtgagtgaaaatgagacgccacataattctctggtcgatgac
gaagagaccgaaggccatcgggaggctatggcgcaggccaaggaaatcaatgccgaactc
ggtcattttttattgaaaacccccgggtcaaaaacaaaatcccagcgacagggcaaagca
ttcaaaaccataccactagcaacggactccagcaatgagacctctaagattgtaagcctt
tctcttctggaagaaaaggaaagaggcgacgatgaagccagggctttacgcacctacacc
agattaaaccgcacccgcttgaccctgtccaccaggttacaggaaaagactccaagtgaa
ccactagacaccacaaccagaaggagctacagcgttccacagcgcttccgtgttcgctca
acaacgcccataccttccaatacagaagacagtgaagaagacgatggggctactaaagac
attgaaggaccatcgccgagctcaacaacggtgacaccatccataaaaatacccaccaga
cgactttttacacccagaaggcccgttagtgctgtagaggactccgattcttctgatatt
ggtaatgacaatgaagaagagttaaaggtggaatcaaccacaagacgcctctacgccggc
ttgaatagactgagaggcaggggaagcaccaccacaaccaccgaggaagctactgattca
accaccgaagcagcaaccacaacatccaaaagtacaaggcaaccttatgtgggcattagt
cgcagagttacaactacaacgaccactgagaagccagcggaaagtagtactgaatataat
gcaagcgaagatgaagaaacggagtccaccactttaactcctgaacaggaggtaaacgat
gatgtcgaaggaaataaggttgcaatcaaggaaacagaagacccgattggcgagcaagct
cccgaagaggctgaagacgacaccactgaagaacccgaactggaagcctatatagacgat
gacaatgaaatcccccaggaagaaagcggacctagaacagaaaccacatcgacatcaacc
acaacgaccaccagtgcaccagcaagcaccacctcacgtcgtcaattggtaattcgtcgc
cgttttaatagcaccataacaacaaccactacggttgccccagatgccgatgacaatctc
gcgaatgagatcgatccaaatgatacggagagttcaacaccaaaaacggcaactacaact
ccatcgaggcggcaacttttaatacgccgacgcttcaatgcgaccaacggtccaacaaca
acgacgactgcaaatcccagtgccgacaatgaaatagatcagggcgagccaaaaagcaca
acgcgtcgaacgattctgtcacgtcggcgatttaatccgacttccagcacagcaaccacg
ccgggatcaacgaacgccgacgagataagcactcgacgtccgtatgcggccttgaaccgc
tcacgtaaccgcttcacaacaccgcaaaccacaacaaccgacggtggggaggacggcgat
gaggatgacgatgaggatgaggatgaggaagaggagcaaccggcaccgccacgtgctgtc
ttccttcaaacaaaccgccatcgcgctctgaaacccactcccgatgaagaggaagatgct
gcagccgcggtgccagcacgtaagccacccaattatgccgcacgtcgcaccaccgcagca
ccactgagagtgagctccagtacgcggcgaaatctggtggcaatcaataggaatctttac
caccgcgcagaagaaatagacgaggaacaggccgaggaggagtacgacgagaacgaggat
gggaatgatgatgaggatcaggaagaatctatagatccccaagtcacaagcaccaccgca
cgctcacgactaagtcaactgctggccaacaggcaaagacagccactcaggaccaccact
caaagacagaatacagatacagaaactgactcggacaacggagatgaaaacgatgaggaa
gataacgatagctccgccgaggtatcgaacagtaaccgcacactaaaccacagcaatact
ttggggggtggcaccactaaccttaacaatcttactaaccgtagcaccgcactgaatgta
gctagtcaacgtagtaacagcaccgtagccaattatattaatcgattcaagtcaaacagt
tacacaaacagaatcaaaccagtcacagtcacagctaatattaaggcagatagtacagat
aaggataatgataatgataatgatggagatgatgatgatgataacgatggtaacgatgat
gataatgatgctagtctagagaatgagggggaggagaaaacgagtggggctggtttgaat
gccttaggtaatgatgttaattccacacgacgctttcagaatcgatatcaattgagccgc
accagaggcagcaccaccaacacgaccccaactacaacacaacaagcccaaacaacaacc
accgccagacgattgacgtttgggggccgtcagcgcgcccaggtaactaaactaacccta
gtcgatgagcagactgaagagaccgagactaagggtgatgcccgcgaagaggacaaggag
gaggaggaggaggaagactccaacgcaaccacaaccacaacaacaaccacaaccaccagc
agaccaacaccgaagcgcatacgtgtgcttaaattccgcagacccttaaatagcaatagc
aatagtaccaccaatgtagatagcaccactaatagcgccactgacactaacccagacacc
atcacagccacaccaacaacagcaggtcaaagcaccaccaccagcaacaacgacaccaca
agcaccaccggcaacaagcgtttccgcaagattgttcgcaaattgaggcctgtggactca
agtactgcggctagtgtggataattccgatgaaaccacccgtaaacctttcgttcccagc
cacaccagatttgctgatcacgagaatgaccttgtcaatctccgccagcggatcaaggag
cagcaagcacgtggtgagccacaggatggagtaattagcaatcgatataagaccctcggc
caaaaggacgatcaggatgtgtcggatttgcaaaagttgagggacaaagtaaaggcagag
caggcgaggggagaaggagaacagggcgtgatcaacgatcgtctgaagaagcttctggcc
gagaagggctcgagcacctccagccaaagagaagaatcttcaactgatagtgactcttcg
tcggtttcttcggccagacccttcttcaaacgaaaactggtggcacgtagaccctacaca
ccaccctcggccactggtggcaccacaaaggctccactgacctttagcaccacccgaccc
acggcgaaattcgtgcgcaggaagaacggaagatttgatcccttcaactcgagtgttcgc
aatcgtggcgagggctttgtgagaagtgatccgcgcggatccagattgcctggagccgat
cgcttcaagtctcagggaaacagcgaagatgatgaagaagtggaagagcgacacgagcaa
ccactgcagaatcagtttgcaaccactttgcgaagaccttttgtcccgaagacgcgacca
gtattggagaagtccaagcctcaagaggaagatgaagcagaagacagcgaggaggaagac
gaggaggaggattccgaggaagatggggacgaagaagaggatgaagaagaagaggaggag
aagccggagggagaagaggagagtgcacaagaggataacaaaccgaagataagctcctct
tacaaaccgaaagataatcgagctccaccgggtagtcgtccaacatttggaaccaccgga
agtgggtcaccaccaaccgcatccggaaatgtacccttcaatccccgcaatcgcccatca
agctcggccaatgcaagtaacacaccaaccaaccgctttggcaccacaaagcgaccccgt
gtggttaaccgaccgccgggagtggcttcacccaacttgaccttgaaacccgtggccagt
gattatgagcgcaccacaccactgacgccactgaaaccggcgccatttatacccagcaat
aacaggagttacgagaggaagtattcgggtccatccacagaggccgcggagacggccagc
gagaattctctgatagaagatttgaatatcgatgccctgaatgcgagaaacaagaagatc
tttgacaagcacagtaaaaagcatccggctctgaagcccaaggtggttaaggtggaatcc
gagacgggattagaggtggaaaccggtacggaggtggcggtggaagaagaaaccaccgag
gaggagcagcaggagcagggctttgtgaccaccacaccaagtacaccaccaccaccacca
tcaccagcaccacccagcacacagtcagacacagccaccaccacagacacgccaccagaa
actgaaacagaaactgaaactgaaacagaaactgaaacagaaaccgaaactgaaacagaa
actgaaaatgtaaccgaaactgaaacagcgaccaatgctaatgaagccacttccatcaat
tcacaggatcaaaccatctcgagcaccactcaagcaacaccgccggccactaccttgttg
catgtgttcaccctcctcgagggtgagggtcaagaagaggagcccacgaccagaaggcca
acggttcgcctctatcccaccatacaaacggaagtggtgcccaagcacaaggtagtcgag
atcaatcgcattgtcgagattaattccaaacaggccaaggctgctcaaaggaaatcaaag
gcgaataatgactttggcatcttgatggtggagtccctgccccacgtggagcagctgggc
gagatcagtgtggtgaaatatgtccacttggtggatggcagtgacattcagatcaacgat
gggcacagcacagtggcggactacacgcccaccgagcccacatcggcggctcaaagtcct
gcctcgctgcccgtaaggaattctctgccagaaaccgaaggcggtgacaccgatcgcagt
ggcaagtccttggtgcctgaagttctaactgccgctttggagacctcgaccatttcgctg
gagggcctatttgattcggccagaaagggcaagcaactgagcagcaatacaatcattggc
gaaacggaggagagcacaaccattggcagtagcagtagttcggccaccgaaaccggggag
accaccacaccggcaccaacttacctgcgacaaccaacgactggcagcgtttcgcggcga
ccggtgttgagtgtccgccggcggataatcaactcgccgacgtcggcagcgattgaaacc
accacgcagcagccagcagcagaaccaccgacgacctccaaatacaaccgactgcgcagc
agaccctccgcagcagcagcagcggcagcagcaacaacgaccactgcagcagcaacaaca
gctttcccagcagcaacatctgctcccggtggcagaaccaccagcaacatctatctgagc
aaactgaaagccaagagcggtgctgcagcagcagcagcagcagcatccggcgaggcagca
acactacagccagcaactagcaacatcagcagcagcagcggcagcaatgacatcacacaa
aagcaacacaagttccagcccgccagctttgctctgcgccgccaatttcaaacgcgtcgg
ctgacaaccttcgcaccagcggccaacggcgaagaaagtgccaccgaggtgcccagaacc
cagaaccctctgttcaagcgccgcctcacccttatatccaccactccgccgtccgcacgc
accaccaacccaccagtttcgggcctggaaaccaccaccactctgtatttgaacgatgac
gacgaggatcaggtggccaagtcgagcattcacacgagccgcttcaaccagataccagag
caggtgcgtccacgcgatgaatacgacttggcattgccaccgcagccactgaagagcacc
atagctagcaccacagctagcaccacagctggcaccacagctagcactactgtcaatcta
ccattaccagttattggccagggaatccgtcgccagttgatcccacgtcctcgtcggccg
cagtcaacgacatctacgccacccaccacgtccactttggggtcatctttgaggtcaact
acgccggctggacactcggctcctcctctctcccgtcgccagcagagtcgtcgtcgtccg
cataaatacatcgaggtttacagtcgtccgccggccaagtctgccgtaatctcggccacc
tcaagtagtcaatttctggatgaggaattctcagtgggtcaaagtcaggtggcccaacgg
cgacgcagtggcagcattctgccaaccaaaagcgatcccaaggtgatcgttcatggtcat
ggcatcattgagtgccgggcacaaggaaatttcccgcatcccctaaactgcaggaagttt
atatcctgcgcccgcttcgaggagaccggtggaatcgtcggatgggagtacacttgtccc
aagggactgacctacgatggcgtcggcggcatgtgcacctggtcgccctcggatcagcca
tgccgggattag

KEGG   Drosophila erecta: 6551647Help
Entry
6551647           CDS       T01060                                 

Definition
(RefSeq) chitinase-3-like protein 1
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6551647
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6551647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 6551647
NCBI-ProteinID: XP_001978494
FlyBase: FBgn0109871
UniProt: B3NXX0
Position
Unknown
AA seq 433 aa AA seqDB search
MGNYEKLEGSSLGKITDELPSQGHRNWKNLRTLVCWSALLSSLVCLFLGFASMGLLGLQT
EELQQVEQRLVCYYASDDTHNLSLLDVPGDLCTHINIGPATLDNATIVLSDALREVLQND
SRTFRAAHPQVHLLLWIGGADSGRQFALMVANHAMRKVFLRSLREILRTYPSLGGIDLDW
EFPSAYDRERMHLSQLLYEIRTEWRREKRPNDILSLAVAAPEGIAFYAYDIRELNLYADY
VNLMSYDFHFFRKDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGL
PTYGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLSETCECASKFFKPNLSYDAESCSPY
LSALQEWISYENQMSIACKANYVKSLNLGGVMVFSLNTDDLRNSCSFLPNLKYNEKAVFP
LTQTIKDVLRESL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggggaactacgagaaactggagggcagttccttggggaagattacggatgagctgccc
agccaaggacaccggaattggaagaacttgagaactttggtctgctggagtgctttgtta
tcgtctttggtgtgcctcttcctcggattcgccagcatgggattgctggggctccaaact
gaggaactccaacaggtggagcagcgattggtgtgctactacgccagcgatgacactcac
aacctgagccttttggacgttcccggcgatctgtgcacccacatcaacatcgggcccgcc
actttggataatgccaccatagtcctttccgatgccctaagagaagtgctacagaacgat
agccgaacctttcgtgctgcccatccgcaggttcatctgcttctctggatcggaggagcc
gacagcgggcggcaatttgcccttatggtggcgaaccacgccatgcgaaaagtgttcctg
cgctccctccgggaaatattgcgcacctatcccagtttgggtggcatcgatctggactgg
gagtttccgagtgcctacgaccgtgagcgaatgcatctctcgcagctgctttacgagatt
agaacggagtggcgacgcgaaaagcgtcccaatgatattctctcgctggcggtggctgct
ccagagggaattgccttctatgcctacgatattcgagagctaaatctgtacgcagactat
gtaaatctgatgtcctatgatttccactttttccgcaaggacacaccatttaccggctta
aatgctccactttatgcccgctcgcaggaacgttcgctgatggccacgttcaacatcaat
tatactgttcagtggtggctgaagagcggtctggagccgcagcggctggttgtgggtctg
cccacctacgggcactcctttacgttggttaatcccctaaatcaccgcataggagctcct
gcttcgggttacggaaaatgtggccaattgggcttcaccacactgtccgaaacttgcgag
tgtgcctccaagttcttcaaaccaaacttgtcctacgatgccgagagctgttccccatat
ttaagcgctctgcaggagtggatatcctacgaaaaccaaatgagcatcgcctgcaaggcc
aactatgtaaagtccctcaatctgggcggcgtcatggtcttctccctgaacaccgatgac
ctcaggaactcatgcagctttttgccaaacttgaaatacaacgagaaagcagtatttcct
ttaacccagaccattaaggacgtcctgcgggagtcgctgtga

KEGG   Drosophila erecta: 6553394Help
Entry
6553394           CDS       T01060                                 

Definition
(RefSeq) endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6553394
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     6553394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14 Mucin
Motif
Other DBs
NCBI-GeneID: 6553394
NCBI-ProteinID: XP_001980219
FlyBase: FBgn0112018
UniProt: B3P403
Position
Unknown
AA seq 595 aa AA seqDB search
MVRYIPLLLLGVLCSWPASTVASDQPSRIVCYFSNWAVYRPGIGRYGLEDVPADLCTHII
YSFIGVNDKGWDVLVIDPELDVDQGGFSKFAQLKKSNPNVKLEIAVGGWAEGGSKYSQMV
AVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVQELRRAFDR
EGRGWEITMAVPVAKFRLNEGYHVPELCESLDAIHAMTYDLRGNWAGFADVHSPLYKRKH
DQYAYEKLNVNDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGG
APGPYTNASGFLAYYEICTEVMDKSKGWTVEWDDAGMVPYTYKDTQWVGYENEASIQIKM
DFIKQKGYAGAMTWAIDMDDFHGMCGKKNGLTQILYDNMRNYRVPEPTRETTPRPEWAKP
PATPPNPDEGAVVAPTMSTTKRPKPKPKPTSSPVKPTSAPVPVPTAGSSTQKPTTKKPKK
PKKTTTTTTTTSAPEKNTEEPEEVVHPVDPVEPVDPEQPMWPQFDPNEIDCTNRDFVPHP
NCRKYFRCVHGKPVEFECKEGTAFHTVLNVCDWIENSDRYYCSRMKKKEKANKAL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtccgatatattccgctcctacttctgggagtgctgtgctcctggccagcttccact
gtggccagtgatcagccttcccgcatcgtctgctacttcagtaactgggccgtgtaccga
cctggaatcggtcgttatggattggaggatgtgcccgccgacctgtgcacccacatcatc
tactcctttatcggtgttaacgataagggctgggatgtgttggtgatcgatcctgagctg
gatgtggatcagggtggcttcagcaagttcgcccaattgaagaaatccaatcctaatgtt
aagctggagatagcagtgggcggctgggccgaaggtggctccaaatactcacaaatggtg
gctgttcgcgatcgccggcagagtttcatacgcagtgtggtacgcttcatgaagcagtac
aacttcgatggattcgacttggactgggaatatccaggagccacggatcgcggtggcaac
tatggcgataaggacaagttcctatatttcgttcaggaactgcgacgagccttcgatcgc
gagggtcgcggctgggaaatcaccatggcggtgccggttgccaagttccggctaaacgaa
ggttaccacgttccggaactgtgcgaatcgctggatgccattcacgccatgacctatgac
ctgcggggaaactgggccggcttcgccgacgtgcacagtccactctataagcgaaaacac
gaccaatacgcctacgagaaactgaatgtgaacgacggccttgcgctgtgggaggagatg
ggctgcccggccaacaagctggtggtgggtgtacccttctacggtcggactttcacgctg
agcaactcgaacaagaactacaacatgggcacctacatcaataaggaggcgggcggcgga
gctccaggtccctacacgaatgccagcggcttcctggcctactacgaaatctgcaccgag
gtgatggacaagtccaagggatggacggtggagtgggacgacgctggaatggtgccctac
acctacaaggacacacagtgggtgggctacgagaacgaggcatccatccagatcaagatg
gacttcatcaagcagaagggctacgccggtgccatgacctgggccatagatatggacgac
ttccatgggatgtgcggcaagaagaacggcctaacgcagatcctctacgacaacatgagg
aactatcgggttccggaacccacaagggagacaacaccaaggcctgagtgggcaaagcca
ccagcaacaccaccaaatccggatgagggcgcggtggtagcaccaactatgagcactacc
aaaagaccaaagcccaaaccgaaacctacttcaagtcctgttaagccaacatccgcccca
gttcctgttccaactgctggcagtagcactcaaaagccaaccacaaagaagcccaaaaag
ccaaagaagacaacaaccaccacaacgaccacttctgcgccggagaagaacactgaggag
cccgaggaagttgttcatcccgtggatccagtggagcccgttgatcccgaacagcccatg
tggccgcagttcgatcccaacgagatcgattgtaccaacagggacttcgttccacatcct
aactgccgaaagtatttccgctgtgtccatggcaagcccgtcgaattcgagtgcaaggaa
ggaactgccttccacacggtcctgaatgtctgcgattggatcgagaatagcgaccgctac
tactgcagccgcatgaagaagaaggagaaggccaacaaggccctctag

DBGET integrated database retrieval system