KEGG   Drosophila erecta: 6544522Help
Entry
6544522           CDS       T01060                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00562  Inositol phosphate metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6544522
   00562 Inositol phosphate metabolism
    6544522
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     6544522
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     6544522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6544522
NCBI-ProteinID: XP_001973048
FlyBase: FBgn0108109
UniProt: B3NHY8
Position
Unknown
AA seq 467 aa AA seqDB search
MRLLILLLLPLVAIAQDDYCFSKDTSRLQTRQFSSKTAYQIVKGTDIDKQYLVPGCQPQK
MWIFHRHGTRLPKTSMIKKAPRVAELRDLIIKNYQVARTKPETDALCQTDLIAIKLWKWN
SSITPDMEEYLTAQGYEDLRGTAKLYQRYYPSVLPPTFNDTYYQFRHTDTQRTTESFKAF
AEGLFGSQNDAHPVEIPKQDLLLRPYDYCSSFKDVNYKDEGSEYFKFHQSKLYNDTLADI
STRLGFLYNLEEADIKLMYDMCRYEQAWNVDRNSVWCGAFLPEQITVFEYLEDLKYYYGS
GYGFPENAHLNCRLVQDLLTHLSNPVSPHVVAHFGHSTGLLTLITALGIQKDDIKLRADN
YDSLTSRRWKSSLIDPFAANFVAVKYDCPADLDREKAVFFLNQQAVQLDWCSVGLCKWSD
VLEKYKTIADADCGEYYCRTGGAPSLGSGVAGLLATTLAAMLVYLMH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctgattctgctactgctgccactggtggccatcgcccaagatgactactgc
ttcagcaaggacacctcccgcctccagacccgccagttctcctcgaagaccgcctaccag
atcgtcaagggcacggacatcgacaagcagtacctggtgcccggctgtcagccccagaag
atgtggatcttccacaggcacggcacacgcctgcccaagacgagcatgatcaagaaggcg
cccagagtggccgagctgcgcgatctcatcatcaaaaactaccaagtggccaggaccaag
cccgaaacggatgccctgtgccagacggacttgattgccatcaagctgtggaagtggaac
agcagcataacccctgacatggaggagtatctgaccgcccagggttacgaggatctcagg
ggcacggccaagctgtaccagcggtactaccccagtgtgctgccccccactttcaacgat
acctattaccagttccgccacacggacacccagcgcaccacagaaagctttaaggctttc
gccgagggtctcttcggatcccaaaacgacgcgcatcccgtcgagattcccaagcaggat
ctactgctgcgtccctacgactattgctcctctttcaaggatgtaaactacaaggatgag
ggctctgagtacttcaagttccatcagtctaagctgtacaacgacaccttggcagatatc
tccactcgattgggtttcctctacaacctggaggaagcggacatcaagctgatgtacgac
atgtgccgctatgagcaggcgtggaatgtggatcgcaatagcgtctggtgcggcgccttc
ctgccggagcaaataacggtctttgagtacctggaggatctgaagtactactacggctcg
gggtatggattcccggaaaacgcgcatcttaactgccgcctggtgcaggacctgctcacc
cacctgagcaacccggtgtcgccccatgtggtggctcacttcggccactcgacgggtctc
ctcaccctgattactgcgctgggaatccagaaggacgacatcaagctgagggcggacaac
tacgacagcttgacgagccgccgttggaagagcagcctgatcgatccgtttgccgccaac
ttcgtggcggtgaagtacgactgtccggcggacttggatcgcgagaaggcggtcttcttc
ctcaaccagcaggcggtgcagctggactggtgcagcgtgggtctgtgcaagtggtccgat
gtgctcgagaagtacaagaccattgcggatgcggactgtggggaatactactgccggacg
ggaggtgctccatcgctgggatccggagttgccggcctactggccaccacgctcgccgcc
atgctggtctacttaatgcactaa

DBGET integrated database retrieval system