KEGG   Drosophila erecta: 6548087Help
Entry
6548087           CDS       T01060                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC24
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
der  Drosophila erecta
Brite
KEGG Orthology (KO) [BR:der00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    6548087
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     6548087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 6548087
NCBI-ProteinID: XP_001975203
FlyBase: FBgn0112881
UniProt: B3NNP6
Position
Unknown
AA seq 278 aa AA seqDB search
MRIRSNPLPRRLVDIMCFLIIGVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVF
NIKGNMIACMMIDTSADVKKLDPTPDQANWRECDECQKLAPPRSWHCKICKVCILKRDHH
CIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWLTVIKLACPML
YLVTGTFWSNLYLLFYSLNILALAYGVILLVYHVPIVLRGGVSADRTKESKVKYDRGVYQ
NLRSVFGNRMHLAWLSPLIRSDLPEDGYHWSVSRNKQD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccggagcaacccactgccccgccggctggtagacatcatgtgcttcctcatc
attggggtctttctgccggtggtgtttatgttcgagattgtggtggtgctgcccgccttc
cacgaaccgggtggcttcttccacaccttcaccttcctaatggccatgttcctggtgttt
aacatcaagggaaacatgattgcctgcatgatgattgataccagtgcagatgtgaaaaag
ctggacccaacaccggatcaggcgaactggcgggagtgcgacgagtgccagaagctggct
ccacccagatcctggcactgcaagatctgcaaggtgtgcattctgaagcgggatcaccac
tgcatctacaccgggtgctgcattggactcagaaaccatcgcttcttcatgggcttcata
ttctatctcttcgtgggatccgtttacgcactggtttacaactccatatacatgtgggtc
atccacggccacatctacagcaactggctgacggtgataaaactcgcctgccccatgcta
tacctggtaacgggcactttttggagcaacctgtacctgctcttctacagcttaaatatt
ttggctctggcttatggagtcatcctgctggtctaccatgtgcctattgttttaagggga
ggtgtttccgccgatcgcaccaaggagagcaaagtaaagtacgaccggggagtgtatcaa
aatctgagaagcgtttttggaaaccgcatgcacttagcgtggctgtccccactgattcgc
agcgatctgccggaagacggataccactggagtgtctctaggaacaaacaagactaa

DBGET integrated database retrieval system