KEGG   Drosophila erecta: 6549373Help
Entry
6549373           CDS       T01060                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
der  Drosophila erecta
Pathway
der03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:der00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6549373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:der03041]
    6549373
Enzymes [BR:der01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     6549373
Spliceosome [BR:der03041]
 Complex C
  Other components
   Step II factors
    6549373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE DUF2075 Flavi_DEAD AAA_30 AAA
Motif
Other DBs
NCBI-GeneID: 6549373
NCBI-ProteinID: XP_001975683
FlyBase: FBgn0112613
UniProt: B3NRD1
Position
Unknown
AA seq 1240 aa AA seqDB search
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDAFRKALLENGAEFP
DSLVENLQRIINLMRPSKPGGDSQEKIGGDKKEDKKSQLLKMFPGLALPNDTFSKKEESD
GEEKVKPDKHAETHKKTDMSDVDAAMMELEALAPGEGNTVVRPPKEVGSKDRHKRRSRDR
DTKRRSRSREDRHSDRRRSRSRDKERRRRSRSRDNRRRSRSREDRDRDRERRHRRSSSRD
RHERRRRSRSRSTDRRDRRDRSKDRSEKMPPPSAAMSDDPEAGKIYSGKVANIVPFGCFV
QLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMTITGQKVSLSMKEVDQDS
GKDLNPLSHAPEDEESLRDRNPDGPFSSSTSMLNLQGNGLDGDEHESRKRVTRISSPERW
EIKQMISSGVLDRCEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDLSP
VRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEMEAVPTSLNKNWIDPLPEEESRSL
AANMRGMGAAPAEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLRDDLIKAVTDN
QILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQE
VGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLL
KTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASL
ITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQ
TRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQ
AAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLL
HFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQC
SDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAW
CYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQ
EGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFF
RFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctgcagaagttggagtacctttcgctggtctcgaagatctgcacggagcta
gacaatcacttgggcatcaacgacaaggacctggccgagtttatcatcgatttggaaaac
aaaaatcggacatacgatgcatttcgcaaggctctgcttgagaatggcgccgaatttccg
gactccctggtcgagaacctgcagcgcatcattaatcttatgcgccccagtaaacctggc
ggcgatagccaggagaaaattggcggcgacaagaaggaagacaagaaatcgcaactgttg
aaaatgttccccggcctggctttgcccaatgacacctttagcaagaaggaggagagcgat
ggcgaagagaaggtgaaaccggataagcatgccgaaacgcacaaaaaaaccgatatgagc
gatgtggatgcagctatgatggaactggaagcgcttgcccccggtgagggcaacacagtg
gtaagaccacctaaggaagtcggttccaaggaccgccacaagcgcagaagtagggatcga
gacacaaagcgacgcagtagatcgcgggaggatagacactctgatcgccgcagaagcagg
tcgcgtgacaaagaacgacgtcgacgaagcagatcccgagataatcggcgcagaagcagg
tcccgcgaggatcgcgatcgagacagagagcgacgccacaggagatcaagctcaagagat
cgccatgaacgccgaagacgaagtcgatctcgttccacagatcgtagagataggagagat
cgatcgaaggatcgcagtgaaaagatgccgccaccgtcggccgccatgagcgatgatccg
gaggcgggaaagatctactccggcaaggtagctaatatcgtaccctttggctgcttcgta
cagctttttggactgcggaaacggtgggaaggcttagtacacatctcacaactaagagca
gaaggacgcgtaacagatgttacggaggtagtcactcggaatcagactgttaaagtgaaa
gtgatgacaataactggccaaaaagtttccttgtcaatgaaagaggtggaccaagactcc
gggaaggatctcaatccactgtcacacgctccagaggacgaggagtctctaagagatcga
aatccagatggtccctttagcagcagcacatcgatgctgaatctgcaaggtaatggtttg
gatggtgatgagcacgagtccaggaaacgtgtgaccaggatctccagtcccgagcgctgg
gaaatcaagcagatgattagttccggtgtgttggacagatgtgagatgcctgatttcgac
gaggaaactggcctattgccgaaagatgaagacgacgaagccgatatcgaaattgagatt
gtggaagaggagccccccttcctctccgggcacggtagagccttacatgatctgtctcca
gtgagaattgtaaaaaatcccgatggctccctagctcaagctgccatgatgcaatcggcg
ttgtctaaggagcgtcgcgaacagaagatgctgcagcgcgaacaagagatggaagctgtg
cctacgagcctcaataagaattggattgatccactgcctgaggaagagagccgcagccta
gcggccaacatgcgaggaatgggtgctgctcccgctgaagttccagaatggaaaaagcat
gtaattggcggcaaaaagtcctcattcggtaagaagactgatctgacgctagtggagcag
cgtcagtcgttgcccatatacaaactgcgagatgatctgatcaaggcggtcacggacaat
cagatccttattgtgattggagaaacaggttcaggaaaaaccacacagatcacccagtat
ttgggcgaatgtggattcactgctagaggaaaaattggctgcacccaacccagaagagtg
gctgccatgtcggtggccaagcgtgtggcggaggagtacggttgcaggttaggccaggaa
gtaggttacaccatccgtttcgaggattgcaccagtccggaaaccataattaagtacatg
actgatggtatgttgctccgtgagtgcctaatggaggcggagttaaaaagttattcggtc
attatgttggatgaagctcacgaacggacgatccatacggatgtgctcttcggcctgctc
aagacagccgtgcaaaagcgaccagaactgaagctaattgtcacatcagccaccttggac
gcggtgaaattctcgcagtacttcttcaaggcgccaatcttcacaattcccggaagaacc
tttcccgtggaggttttatatactaaggaaccagagacggattatttggatgcctctctg
attacagtgatgcaaatccatttgcgagaacctcctggtgacattctgctcttccttacg
ggtcaggaagaaatcgacacggcttgcgaaatcctgtacgaacgaatgaagagtttggga
ccggatgtccctgagctgattattctgccggtgtattcagcattgccatccgaaatgcaa
acgcgtatatttgatcctgcgcccgctggtagccgaaaggttgttatagccaccaatatt
gctgaaacttcacttacaatcgatggcattttctatgtggtagatcctggttttgtgaaa
cagaaggtgtacaactcgaaaacgggcatggactccctggtggttactcccatttcacaa
gcggcagcaaagcaaagagcgggaagagccgggcgtactggcccaggaaaaacctaccgt
ctttatacggaacgtgcgtatcgagatgaaatgctgcccactccggtgccggaaatccag
cgcaccaatctggccacaacagtattgcagctgaagacaatgggtataaacgatctgctg
cactttgattttatggacgctccgcctgtggaatcgctggtaatggcgctcgagcaacta
cattccctctcagcgttggatgatgaaggcctgcttactcggctgggcagacgcatggcc
gagtttcccctcgagccgaatctctccaagatgcttataatgtccgtcgctctgcagtgc
tccgatgagattttgactatagtatcgatgctcagtgtgcagaacgtgttttacaggcca
aaggacaagcaggcactggcggatcagaaaaaggccaaattcaatcaggcggaaggtgac
catctgacgctgctggccgtttacaacagttggaagaacaacaaattctcaaatgcctgg
tgctacgaaaacttcgtacagatccgaaccctgaaacgcagccaggatgtgagaaagcag
ctgctgggaatcatggacaggcataaattggatgtggtatccgctggaaaaaactctgtg
cgaattcagaaggcgatctgctccggtttcttccgcaatgcagcgaaaaaggatccgcag
gaggggtatcgtaccctcgtcgattctcaggtggtttacatccatccgtcgagtgcgctt
tttaatcgccagccagagtgggtcatctatcacgagctggtgcagaccaccaaggagtat
atgcgtgaggttaccacaatcgatcccaaatggctggtagagtttgctccgtcattcttc
cgcttctcggaccccacgaagctaagcaaattcaagaagaatcagcgcctggagccgctg
tacaacaagtacgaggagcccaatgcctggcgtatctctcgcgtccgtcgacgtcgcaat
taa

DBGET integrated database retrieval system