KEGG   Drosophila erecta: 6549499Help
Entry
6549499           CDS       T01060                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X2
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
der  Drosophila erecta
Pathway
der00350  Tyrosine metabolism
der00360  Phenylalanine metabolism
der00380  Tryptophan metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    6549499
   00360 Phenylalanine metabolism
    6549499
   00380 Tryptophan metabolism
    6549499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6549499
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     6549499
    4.1.1.105  L-tryptophan decarboxylase
     6549499
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6549499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 6549499
NCBI-ProteinID: XP_015012062
UniProt: A0A0Q5VJU8
Position
Unknown
AA seq 475 aa AA seqDB search
MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDI
ERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMD
WLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKVKEVKELHPEWDEHTIL
GKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDLAEGLIPFYAVV
TLGTTNSCAFDYLDECGPVGNKHNVWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNP
HKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLW
FVLRLYGVENLQAHIRRHCNFAKLFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEAL
LKRINGRGHIHLVPAKIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAADEMEQEQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccggagttcaaggattttgccaaaacaatggtggactttatagccgaatac
ctggagaacatacgcgaaaggcgcgttctgccggaagtgaagcccgggtacctgaagccc
ctgattccggatgcggcgcccgagaagccggagaagtggcaggatgtgatgcaggacata
gagcgcgtcatcatgccgggagtgacccactggcacagtcccaagttccatgcctacttc
cccacggccaactcgtatccagcgatcgtggcggacatgctgagtggtgcgattgcctgc
atcggattcacgtggatcgccagtcccgcttgcacggaactcgaggtggtcatgatggac
tggctgggcaagatgctggagctgccggcggaattcctggcgtgttcgggcggcaaggga
ggcggcgtcatccagggaacggccagtgagtccacattggtggctctgctgggagccaag
gccaagaaggtgaaggaggtgaaggagctgcatccggagtgggatgagcacaccatcctg
ggcaagctggtgggctactgctccgaccaggcccactcctccgtggagcgtgctggcctc
ttgggaggagtgaagctccgttctgtgcagtccgagaatcacagaatgcgtggtgctgcc
ctggaaaaggccatcgaacaggatctggccgagggtttgattcccttctatgcggtggtc
accctgggcaccaccaactcctgcgccttcgattacttggatgagtgtggaccagtggga
aacaagcacaatgtgtggatccatgtggacgctgcttatgccggatccgctttcatttgc
cccgagtatcgccacctgatgaagggcattgagtcagcagactccttcaatttcaaccca
cacaaatggatgctggtgaacttcgactgctcggccatgtggctgaaggatcccagttgg
gtggtcaacgccttcaatgtggaccctctttacctgaagcacgatatgcagggatccgct
ccggactatcgccactggcaaatcccacttggtcggcgattccgggctttgaagctctgg
ttcgtcctccggctgtacggagtcgagaatctccaagcccacatccgcagacactgcaat
tttgccaaactgttcggggatctctgcgtggcggattccagattcgaactggccgctgag
attaacatgggtttggtctgcttccgtctgaagggcagcaacgagcggaacgaagctctt
ctcaagcgaatcaatggacgcggccacatccacttggtgcctgccaagatcaaggacgtg
tacttcctgcgcatggccatatgctcgcgattcacccagtccgaggacatggagtactcg
tggaaggaggtcagtgccgctgccgacgagatggagcaggagcagtaa

DBGET integrated database retrieval system