KEGG   Drosophila erecta: 6549996Help
Entry
6549996           CDS       T01060                                 

Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
der  Drosophila erecta
Pathway
der04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    6549996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:der01001]
    6549996
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:der03036]
    6549996
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6549996
Protein kinases [BR:der01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   6549996
Chromosome and associated proteins [BR:der03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    6549996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Kinase-like PH C1_1 ZapB Seadorna_VP7 Pkinase_C C1_2 DUF1447
Motif
Other DBs
NCBI-GeneID: 6549996
NCBI-ProteinID: XP_001977462
FlyBase: FBgn0110457
UniProt: B3NVJ7
Position
Unknown
AA seq 1390 aa AA seqDB search
MPAGREPVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRL
KNIEQYAAKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSK
FEMMKRPDSAFFWEERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD
IPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQV
VSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGK
IMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIR
ESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSD
TVDAESKEANVTNSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAG
LRQQIELITKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRN
LENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETEHTQKLKKHNAELDFTVKSQEEKV
RDMVDMIDTLQKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTM
SREQKAQEDNRALLEKISDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEAN
LQEVKALQSKLNEEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKV
AALQSQLDQEHSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLK
STHHEALANNRELQAQLEAEQCFSRLYKTQANENREESAERLAKIEDLEEERVSLKHQVQ
VAVARADSEALARSIAEETVADLEKEKTIKELELKDFVMKHRNEINAKEAALATLKEAEN
ELHKKLGQKGAEYEDLVQQHKKQQEELTLMRSSKDEEITKLVDKCKNEVLLKQVAVNKLA
EVMNRRDSDQAKQKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKHQDLQQLCAE
EQQLKQKMVMEIDCKATEIEHLQSKLNETASLSSADNDPEDSQHSSLLSLTQDSVFEGWL
SVPNKQNRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGD
VIRADAKEIPRIFQLLYAGEGASHRPDEQSQLDVSVLHGNSNEERPGTIVHKGHEFVHIT
YHMPTACEVCPKPLWHMFKPPAAYECKRCRNKIHKEHVDKHDPLAPCKLNHDPRSARDML
LLAATPEDQSLWVARLLKRIQKSGYKANSSNNNSTDGSKISPSQSTRSSYKPYAVNVQRS
ATLPANSSLK
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgccagctggacgagaacctgtgaccaagcagcgcagcatggatgtggaacgaaggcgc
cgggcaaatacgctcgagcgcgagatgcgcgatccgaccagcatctgcaatgtggactgc
ctgctggacacggtgtcggcgctggtcagcgattgtgaccacgaatccctaaggcggctt
aagaacatcgagcagtatgcggccaaatacaaaccgttggccatgcagatcaatcagctg
cgcatgaacgtcgaggatttccacttcatcaaactcatcggcgccggcgcctttggagag
gtgcagctggtgcggcacaagtcctccagccaggtgtacgccatgaagcggctgtccaaa
ttcgagatgatgaagcgtccggactccgcgttcttctgggaggagcgacatatcatggcg
cacgccaactccgaatggatcgtccagctgcactttgcctttcaggatgccaaataccta
tacatggtaatggacttcatgcccggcggcgacatagtctcgctgatgggtgactacgac
atcccggagaagtgggctatcttctacacgatggaggtggttctcgcgctggacaccatt
cacaacatgggattcgtgcatcgagacgtaaagccggacaacatgctcctcgacagttat
ggccacttgaaactggccgactttggcacctgtatgcgaatgggcgccaacggtcaggtg
gtgtccagcaatgcggtgggcacgccggactacatcagcccggaggtgctgcagtcgcag
ggcgtggacaacgagtacggacgggagtgcgactggtggtcggtgggcatcttcctctac
gagatgctgttcggcgagactcccttctacgcagactcgctggtgggcacctacggcaag
atcatggaccacaagaactcgctcagctttccacccgaggtggagattagcgaacaggcc
aaggccctgatccgcgcctttctcacggaccgaacgcaacgtttggggcgctacggcatc
gaggacatcaaggcgcatccgtttttccggaatgacacctggtcgtttgacaacattcgt
gagagtgtgccgcctgtggtgcccgagctctcctccgacgatgatacgcggaatttcgag
gacattgagcgggacgagaaaccggaggaagtgtttcccgtacccaagggcttcgatggc
aaccacctgcccttcatcggcttcacgtacacgggcgactatcagctgctgtctagcgac
accgtggatgcggagtccaaggaggccaatgtgacaaatagcggggcggccagcaataat
cacggccacgggcacaatcaccgccatcgtccgtcgaactccaacgagctgaaacgcctg
gaggcgctgctcgagcgggagcgcggccggtcggaagctttggagcagcaggacgctggc
ctgcggcagcagatagagctgataacaaagcgcgaggcggagctgcagaggattgcctcc
gagtacgagaaggatctggcattgcgccagcacaactacaaggtggccatgcagaaggtg
gagcaggagatcgagctgcgcaagaagacagaggcactgctcgtggagacgcagcgcaat
ctggaaaacgagcaaaagacgcgggcccgcgacctcaacatcaacgacaaggtggtctca
ctggaaaagcagctgcttgagatggagcagagctacaaaaccgagacggagcacactcaa
aagctgaagaagcacaatgccgagctggacttcacggtcaagtcgcaggaggagaaggtg
cgcgacatggttgacatgattgacacgctccaaaagcataaggaggagctgggccaggag
aatgccgagctgcaggcgcttgtggtgcaggagaagaatctgcgatcgcagctcaaggag
atgcataaggaggccgagaacaagatgcagacgctaatcaacgacatcgaacgtactatg
agtcgcgaacaaaaggcccaagaggacaaccgggcgctgcttgagaagatcagcgatttg
gagaaggcgcatgccggcctcgacttcgaactgaaggcggcccagggtcgctaccagcag
gaggtcaaggcccaccaagagaccgagaagtcgcgcctcgtctcccgcgaggaggccaat
ctgcaggaggtaaaggcactgcagtccaagctcaacgaggagaagtccgctcgcatcaag
gccgaccagcattctcaggaaaaagagcgtcagctgagcatgctgtccgtggactatcgc
caaatccaactacgcctccagaagctagaaggcgagtgccggcaggagtcggagaaggtg
gccgcccttcagtcgcagctcgaccaagagcacagcaagcgcaatgccttgctctcagaa
ctcagtctgcacagctctgaggtggcacacctacgatcccgcgaaaaccagctacagaag
gaactgtctacccagcgcgaggcaaagcgacgcttcgaagaggacctaacccagctaaag
agcacccaccacgaggcgctggccaataaccgtgagcttcaggcccaactggaggcggag
cagtgcttctcgcggctatacaaaacacaggcaaacgagaatcgcgaagagagcgctgag
cggctggcgaagatcgaggatcttgaagaggaacgggtctcacttaagcaccaggtgcag
gtggctgttgcccgcgcagactcagaggctttggctcgctccattgccgaagagacggtg
gcggatctcgaaaaggagaaaactatcaaggagctagaactgaaggacttcgtcatgaag
caccgcaacgagatcaacgccaaggaggcggccttggccacactcaaggaggccgagaac
gaactgcacaagaagctgggccagaagggagccgagtacgaggatcttgtccagcagcac
aagaagcagcaagaggaactcacgcttatgaggagcagcaaggacgaagagatcaccaag
ctggtggataagtgcaagaacgaagtccttctcaagcaggttgcagtgaacaagttggct
gaggtgatgaaccgtcgcgactccgaccaggccaaacaaaagaacaaggcgcgctccacc
gccgagctgcgcaagaaggagaaggagatgcgtcgactgcagcaggagctatcgcaggag
cgggacaagttcaaccagttgctgctcaagcaccaggacctgcagcagctgtgcgccgag
gagcagcagctcaagcagaagatggtcatggagatcgactgcaaggccaccgagatcgag
cacctgcagagcaagctcaacgagacggcgtcgctctcctcggcggacaacgatcccgag
gatagccagcactcctctctgctctccctcacacaggactcggtcttcgagggctggctg
agtgtgcccaacaagcagaaccggcgacgtggccacggctggaagcggcagtacgtaatt
gtgtcgtcgcgcaagattatcttctacaactcggacattgacaagcacaataccacggat
gccgtgctcatcctggacctgagcaaggtgtaccacgttcgtagcgtcacccagggcgat
gtcatacgcgccgatgccaaagagattccacgcatcttccagctgctgtacgccggcgag
ggcgcctcccaccgtcccgatgagcagagccagttggatgtgagcgtgctgcacggtaat
agcaacgaggagcgcccgggcaccattgtccacaaaggtcacgagttcgtccacatcacc
taccacatgcccacggcctgtgaggtgtgcccgaagcctttgtggcacatgttcaagccg
ccggcggcttacgaatgcaagagatgccgcaacaagatacacaaggagcatgtggacaag
cacgacccgctggcgccctgcaagctgaatcacgatccgcgcagcgcccgcgacatgctg
ctgctggccgccacgcccgaggaccagtcgctgtgggtggcgcgcctgctgaagcgtatc
caaaagagtggatacaaggccaactcgtccaacaacaacagcaccgatggcagcaagata
tcgcccagccaatcgacgcgctcctcctacaagccgtatgcggtaaatgtccaacgctcc
gccacgctgccagccaattcatcgcttaaatga

DBGET integrated database retrieval system