KEGG   Drosophila erecta: 6550368Help
Entry
6550368           CDS       T01060                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase isoform X1
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
der  Drosophila erecta
Pathway
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    6550368
Enzymes [BR:der01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     6550368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 6550368
NCBI-ProteinID: XP_001977865
FlyBase: FBgn0110222
UniProt: B3NWH2
Position
Unknown
AA seq 417 aa AA seqDB search
MDIRVKCTDEEPEALEQEIPARRQRLLQFTNCRLVRGHRIIHEDLWVRDGRIVNPEPVFF
DERAKAHCRIDCGGAIVAPGYIDLQINGGYGVDFSHDTETIEEGVAMVARGLVKSGVTSF
CPTLVTSPSDSYHTILPRIPAEVSRGAGILGIHVEGPFINPQKKGAHPEHCIQTIDKGLS
TLKETYGSLDRIKIITLAPEKVTDPEVIGQLVERGITVALGHSMASLSDGEGAVQQGATL
ITHLFNAMLPFHHRDPGLVGLLASDAVPHGRTVYFGIISDGVHTHPAALRIAYRTHPQGL
ILVTDAISALGLEEGVHHIGQLPLEVKQGKAFIAGTETLCGSIAPMDECVRIFQKATDCS
VVYAIEAATLHPAQCLGIEQQKGTLDFGSDADFILLDDQLRVLSTWIAGVCVHRTAK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggacatccgggtgaagtgcaccgacgaggagccggaggctctggagcaggagatcccg
gcgagaagacagcgcctgctgcagttcaccaactgccgcctggtgcgcggccaccggatc
atccacgaggatctgtgggtgcgcgacggtcggatcgtgaatccggagcccgtgttcttc
gacgagcgggccaaggcccactgtcgcatcgactgcggaggagccatcgtcgcacccggc
tacatcgacctccagatcaatggtggctatggcgtggacttctcccacgacacggagacc
atcgaggagggcgtggccatggtggcacgcggcctggtcaagagcggggtgacctccttc
tgccccacgctggttacctcgcccagcgacagctaccacaccatactgccgcgcattccc
gcagaggtttccaggggagccggcatcctgggtatccatgtcgagggtccgttcatcaat
ccgcagaagaagggcgcccatccggagcactgcatacagaccatcgataagggactcagc
acgctgaaggagacgtacggctcgctggaccgcatcaagatcatcaccctggcgccggag
aaggtcaccgacccggaggtgattggccagctggtggaacgaggcatcaccgtggccctg
ggccactcgatggcctcgctgagcgatggcgagggagccgtgcagcagggcgccaccctg
atcacgcacctgttcaacgccatgctgccgttccaccaccgcgatcccggcctggtggga
ctgctggcctcggacgcagtgccgcacggaaggaccgtgtacttcggcatcatctcggac
ggcgtgcacacgcatccggcggcgctgagaatcgcctaccgcacacatccgcagggcctg
atcctggtcacggacgccatatcggcgctgggactcgaggagggagtgcatcacatcgga
cagctgccgctggaggttaagcagggcaaggcgttcatcgcaggcacggaaacgctgtgc
ggcagcatcgccccgatggacgagtgcgtgcggatcttccagaaggcgaccgactgctcc
gtggtgtacgccatcgaggcggccaccttgcatccagctcagtgcctggggatcgagcag
cagaagggaaccctggactttggctcggacgcggacttcattcttctggacgaccagctc
cgggtgctatccacctggatcgcgggtgtatgtgttcaccggactgccaagtag

DBGET integrated database retrieval system