KEGG   Drosophila erecta: 6551873Help
Entry
6551873           CDS       T01060                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
der  Drosophila erecta
Pathway
der00350  Tyrosine metabolism
der01100  Metabolic pathways
Module
der_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    6551873
Enzymes [BR:der01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     6551873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 6551873
NCBI-ProteinID: XP_001980823
FlyBase: FBgn0109599
UniProt: B3NZS1
Position
Unknown
AA seq 246 aa AA seqDB search
MASATQLTHKGIHLAGLCRSTWSKPLSRNMATKPILYSFWASSCSWRVRAALAIKKIEYD
ITPTSLLKTVSGHAYTDAYREVNPMQKVPSLKIDGHTLCDSVAIMHYLEETRPQPALLPQ
DPVRRAKVREIVELICSGIQPLQNVGVLDHLGKDQSLQWAQHWISRGFQGLEKVLSQSAG
KFCVGDELSMADICLVPQVRNARRYKTDLTPYPTIVRLNQELLELDVFKATHPSTQPDCP
PKFAKK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctacacaattgacccacaaaggcatccacttggccggattgtgcaggtcc
acctggtccaagcccttgtccagaaatatggcaacaaagcccatactgtattccttttgg
gctagttcgtgctcttggagagttcgcgctgcactggctatcaagaagatagagtatgac
attacgccgacttccttgctgaaaacagtcagcggccatgcctatacggatgcatatagg
gaagttaatcccatgcaaaaggttccctccctgaagattgatggtcacaccttgtgcgac
tcggtggctattatgcactacctggaggaaactagacctcagcccgcacttctgcctcaa
gatccagttaggagagctaaggtgcgtgaaatcgtggagctcatttgctccggcatccag
ccgctgcagaatgtgggtgtcctggatcatttgggcaaggatcaaagcttgcaatgggcc
caacactggatttctcgaggatttcaaggtctggagaaggtactatcccaatcggcgggt
aaattctgcgtgggagatgagctcagcatggccgatatttgccttgtacctcaggtccgc
aatgccaggagatacaaaactgacctgaccccatatcccaccatagtacgcttgaatcag
gaactactggaactggatgtgttcaaagccactcatcccagtacccagccagattgtcca
cctaaattcgcaaagaaataa

DBGET integrated database retrieval system