KEGG   Drosophila erecta: 6553649Help
Entry
6553649           CDS       T01060                                 

Definition
(RefSeq) Fanconi anemia group D2 protein
  KO
K10891  fanconi anemia group D2 protein
Organism
der  Drosophila erecta
Pathway
der03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    6553649
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:der03400]
    6553649
DNA repair and recombination proteins [BR:der03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     6553649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2
Motif
Other DBs
NCBI-GeneID: 6553649
NCBI-ProteinID: XP_001979383
FlyBase: FBgn0107400
UniProt: B3P327
Position
Unknown
AA seq 1478 aa AA seqDB search
MYKQFKKRSKKPLNTIDENATMKVPRLAETTTNISVESSSGGSEDNIPASQEHTQRFLSQ
HSAILAATLGRTQSSNRNFATLSRQPNNFFELVLVRAGVQLDQGDSLILACDHVSIVSKL
RDIFTTATSYTDKMETFKTGLNAAMAPDSKLVQKLLTGCTVDAAGEEQIYQSQNSIFMNF
LMIDFMRDACVEVLLNKIEEVATADRVIMGKAAIPLPLLPLMLTQLRYLTASHKVEIYSR
IEVIFNRATESAKLDIIANAELILDASMHDEFVELLNINYSSTEDLFHMTTVQTLSNLSL
SDRTQAKLRLRILDFATSGHCSDAALPHLIRLLLNVLKMDTDDSVRDLIGTLREIFNWRH
TIAREENSERGDSKQSQLELFSFLELGLIRSKKFYQACQRSSAGVPAEEFTSLDLILLLL
LIHVNEDNALYIENILRRRIKLEHITVSILEEIRLHYRHILEQHITTLMNILHDFMREKN
RTVSDFAKSSYSILFKIFNSIQKNILKKLLELTCDKSSPHLTTMALELLRELQRKSAKDV
QNCATLLIPMLDRISDLTLTQTRVAMDLLCHVAFPDPTLSPCLQLQEQVDMVVKKQLINS
IDTIKKQGIIGCVQLIDAMARIENDGVERDDLIASVENVDSLPDGRGKMAANLIIRTESS
IGNSTESLALFFEELASVFNQRNEGTTGCDLDYQFIAWVCDLVTFRFQASFVTEDVPETL
KGIKLEYQLNINELDDTNVNTESDVLNIGINISKLVLSPKAKACDSIYMLAPLFNCVRVL
YKHRHHDSLENINALLGCAIVLPSFFEDDNYVPVFDNFEAEQQKDILSIYFHTVNWMRVS
ISAFASQRDAPTRRRVLSRLGELIRIEQRIKPLLARAPDDFVAPPYQFLTNAKLSTQNLK
RPGPKPAAKMNATLPEPDLTGNQTTIADFTIKVGPCKTIKTKTDFEQMYGPRERYRPMEV
EIIMLLVEQKFVLNHQLEKEQVGEFLGLLELRFLLEDLVQKLEAAVLRQHDSFDVDSFKP
HLSKPEDFICDLLPCLHEVNNHLITLAEAIDNELTKVNHVYSNLDLFKEKFCYIKSCFGL
CVRLFALYFAWSEWSDKSQEQLLHKSLLKLQPQAKWKSLEKQSVPQLATLTFQYFLKYEK
SVLNLSTAVQLHRLLCNLLKLGSLQSDASQPRFQQAEDLRILCGTLLRRKWFHYAGTLDK
GGQCNIYLDELIKGFLKKSTSKSQTDLLSELVKQCNILNTKDKALTSFPNFKKANFPLLF
RGLCEVLIHSLSGQVSVDRHGDRLKLWESAVDLLNGLLSIVQQVEQPRNFGLFLKHSLLF
LKLLLQHGMSALESIVRDDPERLTRFLHELQKVTRFLHQLCCHSKFIKNTAIISYIPSLR
ETIETLVFRVKALLAANNCHSAFHMGNMINRDLHGDSIITPTSSFAGEENSDDELPADDT
SVDETVLGDDMGITAVSVSTRPSDGSRRSKSSSRSKCF
NT seq 4437 nt NT seq  +upstreamnt  +downstreamnt
atgtataaacaatttaaaaaacgatcgaagaaacctttgaacacgatcgatgagaacgcg
accatgaaagtgccccgcctggcggagacgaccacaaatatttccgttgagtcctcatcc
ggcgggagcgaggacaacatacccgcctcccaggagcacacgcagcgcttcctgtcgcag
cacagtgcgatcctggccgccactctgggtcgcacgcaatcctccaaccggaactttgcg
acgctctcccggcaaccgaacaacttcttcgaactggtcctggttcgagcaggtgtccag
ttggaccagggtgatagcctgatcctggcctgcgatcatgtctccatagtctccaagctg
cgggacatctttacgactgccacctcatataccgacaaaatggagacattcaagacgggc
ctgaatgctgccatggcgcccgactcgaagctggtgcagaagctactaaccggctgcacc
gtggacgcagctggcgaggagcagatctaccagtcccagaacagcatctttatgaacttc
ctcatgatcgacttcatgcgagatgcctgcgtggaggtgctgctgaacaagatcgaggag
gtggctacagccgatcgagtcatcatgggtaaagcagctattcccctgccactgctaccc
ctgatgctgacccaactgcgctacttgaccgcctcgcacaaggtggagatctacagtcgc
atcgaggtcattttcaacagggccacggaatcggcaaagctggacatcatagccaatgct
gagttgatactcgatgccagcatgcacgatgagttcgtcgagcttctaaacattaactat
tccagcactgaagacctctttcacatgactacggtgcaaactctgagcaacttatcgctt
tcggacagaacgcaggccaagttacgactgcgcattttggacttcgccacaagtggccac
tgttccgatgcggcattgccacatcttataaggctgctgctaaacgttctgaaaatggac
acagatgacagcgtgcgcgacttgataggcaccttacgagaaatcttcaactggcgtcat
acaattgcgagggaagaaaactcggaaagaggcgacagtaagcagtctcagctggaactt
ttcagcttcctagaactaggattaatacgctcgaaaaagttttatcaagcatgccaaagg
tcatctgctggtgtgcctgctgaagaattcacctccttagaccttatacttttgcttttg
ttgatacatgttaatgaagacaatgcattgtacatcgaaaacattcttcgtcgtcgaatt
aaactggagcacataacagtgagcattttggaagagatacgactgcattatcgacatatc
ttggagcagcacataactacactgatgaacatccttcacgactttatgcgagagaaaaat
cgcactgtgtccgatttcgccaagtcttcatacagtattctttttaagatttttaactcg
atccaaaaaaatatcctaaagaagctgttggagctcacctgtgacaaatcatcgccccat
ctgacaacaatggcactggaattgcttcgtgagcttcaaagaaagagcgccaaggatgtt
cagaattgcgccactcttcttattcccatgctggataggataagtgatttaactctaaca
caaacgcgcgttgctatggaccttctgtgccatgttgcctttccggatccaaccttatcg
ccctgcctgcaactccaagagcaagttgatatggtggttaaaaagcagctgatcaattcc
attgatactattaaaaagcagggcataattggctgtgtgcagctcatcgatgcaatggca
cgcatcgagaatgatggtgttgagcgtgacgaccttatagccagcgtggaaaacgtcgat
tcgttgcccgatggccgaggcaaaatggcagccaacctaatcatacgaaccgagtcatca
ataggaaatagtaccgagtccttagccctgttttttgaagaactggcctcggttttcaat
cagcgcaatgaaggaaccaccggctgtgacttggactaccaattcattgcttgggtctgt
gacttagtgacattccgatttcaggcaagttttgtcacagaggatgttcccgagacttta
aagggaattaaactggaatatcagttaaatatcaatgaattggacgatacaaacgtaaac
actgaatcggatgtccttaatattggcataaatatatcaaaactggttttatcaccgaaa
gcaaaagcctgtgactcaatatacatgctggctcccctgttcaactgtgtcagagtgctg
tacaaacatcgccaccatgacagcttagagaatatcaatgccttgctaggctgtgccatt
gtgttgccctcattctttgaggatgacaactatgtgcccgtttttgacaactttgaggcg
gagcagcaaaaagatatactgagcatttattttcacaccgtcaattggatgagggtgtcg
atcagtgcgtttgcatcacaacgtgatgctcccactcggcgtcgagttctttcaagactc
ggagagctcatacgtatcgaacaaagaataaagcccctcctggctagagcgcctgacgac
ttcgtggcaccgccatatcagttcctcaccaacgccaagctatcaactcagaatctgaaa
cgtccaggacctaaaccagctgccaaaatgaacgcaactctaccagaaccagatttaact
ggtaatcaaacaacgatcgcagactttaccattaaggttggaccgtgcaagaccattaag
acgaagactgactttgagcagatgtatgggccccgagagaggtacaggccaatggaagtg
gaaatcatcatgctattggtcgagcagaagtttgttttgaaccaccagctagagaaggag
caagtgggggagtttcttggtctcctggagttacgtttcctactggaagacttggttcaa
aaacttgaagcagcagtacttcgacagcacgattcttttgatgtggacagttttaagcct
catttgtccaaaccggaggattttatttgcgatttactcccatgtctacatgaggtgaat
aatcacttaataaccctagcagaagccatcgacaatgagctcacgaaagtcaatcatgtg
tacagcaatctggatctgtttaaagagaaattttgctatatcaaatcgtgttttgggctg
tgcgtccgtctgttcgccttgtacttcgcctggagcgagtggagcgataagtcgcaggaa
caactgctccataagtctttgctaaaactacagcctcaggccaaatggaagagcctagag
aagcaaagtgttcctcagctggcaaccctgacctttcaatactttctaaaatatgagaaa
tctgtcttgaatcttagtactgcggtccagcttcatcgattgttgtgtaacttattgaag
ctggggagtttgcaaagtgatgctagccaaccgagatttcagcaagccgaggatttacgt
atactgtgtggcactctgctgcgccgtaaatggttccactacgctggtaccttggacaaa
ggcggacagtgcaatatctatttggacgagctgatcaagggatttctaaaaaaatcgact
tccaagagtcaaaccgacctgcttagtgagctggttaaacaatgcaacatactgaatacg
aaggacaaagccctgacttcctttcccaactttaaaaaggccaacttcccattactcttt
cgcggactgtgcgaggtccttattcactccctaagtggtcaagttagcgtcgaccgtcat
ggtgatagattgaagctatgggagtctgcagtggatttgttgaatggcttgctcagcatt
gtgcagcaggtggaacagccaagaaattttgggctgtttctgaaacactccctgttattc
cttaagttgctgcttcagcacggaatgtctgcgctggaatctattgttcgggatgatcct
gaaaggctaacaaggtttttgcacgagctccagaaggtgacacgctttctgcatcaactc
tgctgccattccaagttcattaaaaatactgctatcataagctatattcccagccttcgg
gagacgattgagacgctggtcttccgagtgaaagcccttttggccgccaacaactgtcat
tctgcatttcacatgggcaatatgatcaacagggatctccacggagattctattataaca
ccaacgagttccttcgccggcgaggaaaacagcgacgacgaattacctgcggacgacacc
agcgtagatgaaactgtcttgggagatgacatgggtatcaccgccgtaagcgtgagcacg
aggccgagcgacggtagtcgccgtagcaagtcctcttcccgcagcaaatgcttttaa

DBGET integrated database retrieval system