KEGG   Drosophila erecta: 6554041Help
Entry
6554041           CDS       T01060                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
der  Drosophila erecta
Pathway
der00020  Citrate cycle (TCA cycle)
der00640  Propanoate metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00009  Citrate cycle (TCA cycle, Krebs cycle)
der_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6554041
   00640 Propanoate metabolism
    6554041
Enzymes [BR:der01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     6554041
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     6554041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 6554041
NCBI-ProteinID: XP_026834870
FlyBase: FBgn0108187
Position
Unknown
AA seq 342 aa AA seqDB search
MSLNRGSKMLLRAITPQVLRRGKADYGKTVCNLKINKQTKVLVQGFTGKQATFHSEESIK
YGTNIVGGVNPKKGGTEHLGKPVFKSVAEAVEKAKPDATVIFIPPPSAAEGICSAIESEI
GLIVAITEGIPQVDMVRILQMLKCQEKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVG
IVSRSGTLTYESVHQTTNVGLGQALCVGLGGDPFNGTSFIDALKVFLSDKEIKGIVMIGE
IGGSAEEEAADFLKEKNTGCEAKPVVGFIAGQTAPPGRRMGHAGAIIAGGKGAAKDKVAA
LEKVGVRMTANPCHLGSTLLEEMIRLKLVPKPNEKKAQAGKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaatcgaggaagcaagatgctcctgcgggcgattacgccccaagtgttgagg
cgtggcaaggcggactatggcaagacggtgtgcaacctgaagatcaacaagcaaacaaag
gttctggtgcagggattcaccggcaagcaggccactttccactcggaggagtccataaag
tacggaaccaatatagttggcggcgtgaatcccaaaaagggcggtacggagcatctgggc
aagccggttttcaaatcagtggcagaagctgtggagaaggcgaagccagatgccaccgtg
atcttcataccacctccatccgccgccgagggaatttgctcggccatcgagagtgaaata
ggcctgattgtggccatcaccgagggcattccccaggtggacatggttcgtatattgcag
atgctgaagtgccaggaaaaatcccgcctgctgggacccaactgcccgggaatcatctcc
ccggatcagtgcaaaatcggcataatgccgggagatattcacaagcgaggagtggtgggc
atagtctcgcgttcaggaactttgacctacgagtccgtccatcagaccaccaacgtggga
ttgggtcaggctctttgtgttggcctcggcggagatcccttcaacggaaccagcttcata
gacgccctcaaggtatttctttccgacaaggagatcaagggcattgtcatgatcggagag
attggcggatccgccgaggaagaggccgccgattttctcaaggagaaaaacacaggctgc
gaggccaagccagtagttggcttcatcgcaggacagactgctcctccgggtcgccgaatg
ggtcatgccggcgccatcattgctggtggtaagggagcggccaaggacaaggtggccgcc
ttggagaaggtgggagttcgcatgaccgccaatccctgccacctgggctccacgctcctg
gaggaaatgatccgtttgaaactggtgcccaagccgaacgaaaaaaaggcgcaggctggc
aagaagtag

DBGET integrated database retrieval system