KEGG   Drosophila erecta: Dere_GG10480Help
Entry
Dere_GG10480      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00020  Citrate cycle (TCA cycle)
der00620  Pyruvate metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG10480
   00020 Citrate cycle (TCA cycle)
    Dere_GG10480
   00620 Pyruvate metabolism
    Dere_GG10480
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dere_GG10480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3614 Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 6542519
NCBI-ProteinID: XP_001970156
FlyBase: FBgn0102788
UniProt: B3N6C8
Position
Unknown
AA seq 510 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSAGNVVVRALSCQLINSRNLQSIRSKLTTS
QSPIAWSYNFARAYSNLPDHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAGAPPPAP
AAAPAPAAAPAAAPPPPPAAAPVAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRL
QGKGSGVHGSIKSGDLAGQKAAAKPAAAAPAKAPRAAGARYEDIPVTNMRAVIAKRLLES
KTQLPHYYVTVQCQVDKLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLKVPEANSAW
MDTVIRKYDDVDVSVAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEF
QGGTISVSNLGMFGVNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLS
ADHRVVDGAVAARWLQHFRDYMEDPSNMVL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaactcggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcggccggaaatgtggtggtgcgcgccctc
agctgccagctgatcaactcccggaatctccagagcatcaggtcaaaacttaccactagc
cagtcaccgatcgcatggagctacaacttcgcccgtgcctattccaaccttccggatcac
attagggtgccactgcctgctctttcccccaccatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagcttaacgaaggtgacctgctgtgcgagattgagacggac
aaggccaccatgggctttgagacgcccgaggagggctttctggccaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcataatcgtgcctgaccaaggt
agcgtagctgccttcgcgaacttcaaggacgacggtgccggcgcaccaccaccagctccg
gcagcagctccagcgcccgcagcagcaccagctgcagcaccgccaccaccacccgccgca
gctccagtagccgctgcgcccccaccagctcccgccgctgctccagctgcagcaggtaca
gggcgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctgcgtcta
caaggcaagggcagtggagtccatggctcaattaaatctggtgatcttgcaggccagaaa
gcggcagccaagccagctgctgcagcacctgccaaggcccccagggcagctggagcccgc
tacgaggacatcccggtgaccaacatgcgcgcagtgattgccaaacgcctgctggagtcc
aagacccaactgcctcactactacgtcaccgtgcagtgccaagtggataagctcctgaag
ttccgcgcgaaggttaacaagaagtacgagaagcagggtgcccgcgtctctgtgaacgac
ttcatcatcaaggccgtcgcgatcgccagtcttaaagttcccgaagcgaactcggcctgg
atggacacagtaatccgaaagtatgacgacgttgatgtctcggtggccgtctccacagat
aagggtctgattacccccattgtcttcaatgccgaccgcaagggagtcctggagatctct
aaggatgtcaaggcgctggcagccaaggcgcgtgacaacaaactgcagccccacgagttc
cagggcggcaccatctcggtgtctaatctgggcatgtttggtgtgaaccagtttgccgct
gttatcaaccctcctcaatcgtgcatccttgccattggcaccacaacgaaacagttggtt
gcggatcctgacagcctcaagggtttcaaggaggtcaacatgctgaccgtcaccctgagc
gctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcagcacttccgcgac
tacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system