KEGG   Drosophila erecta: Dere_GG10832Help
Entry
Dere_GG10832      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG10832
Chromosome and associated proteins [BR:der03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dere_GG10832
   HAT complexes
    HATB complex
     Dere_GG10832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 6552600
NCBI-ProteinID: XP_001978993
FlyBase: FBgn0103137
UniProt: B3NYH0
Position
Unknown
AA seq 404 aa AA seqDB search
MAQIEKYQDLVIDALEVVDFKLIRDKADINNDALTFHPAMAHQIFGETETIFGYQDLHVR
VMYTAGPLHIYLGVDYGKRVNEISGGEIKADDVVSTIAQSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKISEYKRVSDDGSERLFEIYQCDYKSLSFLKFFARLQTFILWFVDAASYIDT
DDPQWCYFLCYEKYKNNDGQYQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLA
TQLVESIYKFYQSQKNVVDITVEDPSEEFQRLRNFVDARSCMELKSFARGEIVKGFNKEM
VREAREALKLNPRQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKM
ERFKMDTEMLRARLPTIQQRMEQLQEEYRVVEQDYQSTIAKLRA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatcgagaagtaccaggacctggtgatcgatgctctcgaagtggtggacttt
aagctgatccgagacaaggccgacatcaacaatgacgccctgactttccatcccgcaatg
gcccaccagattttcggcgagaccgagaccatcttcggctaccaggacttgcacgtgcgt
gtaatgtacacggcaggacctttgcacatctacctgggcgtcgattacggcaaacgggtg
aatgagatctccggcggagagatcaaagccgacgacgtcgtcagcacaattgcccagagt
ctgccagacggctgctacttcatcaatcttgatgagtttctcaagactctggacaaggct
gacaaattccagcccttcggagagaagattagcgaatacaaacgggtatcggacgatggc
agcgagcgccttttcgagatctaccagtgcgactacaagagcttatcattcttaaagttc
tttgcccggctgcagacattcatcttgtggttcgtggacgctgcctcctacatcgacact
gatgatccacagtggtgctacttcttgtgctacgaaaagtacaagaacaacgatggccag
tatcaatacgccacagctggttacaccaccgtatacgagtactacgcctatccccaaaac
aagagacccaggataagtcagatgcttatactgccgcctttccagaaactcggcttggct
acccagttggtcgagagcatttacaaattttatcagtcgcagaagaatgttgtggacata
acagtggaggatccatctgaggagttccagcgcttgcggaattttgtagacgcgcgatct
tgcatggaattgaagtcgtttgcccgaggcgagatagtcaagggttttaacaaggagatg
gtgcgggaagctcgcgaggctctgaagctcaatccccgccaggtgcgtaaagtgtacgag
ctgttgcgtctattctacaccaatgtgaaggatgaaaaggagtaccggccctatcgtctg
gaagttaagaaacggcttaacgcggtctattacaagcagttgaaggatttaaagaaaatg
gagcgcttcaagatggacactgaaatgctgcgtgctcgcctgccaacgattcaacaacgc
atggagcagctgcaagaggaatacagggtggtcgagcaagattaccagagcaccattgcc
aaattgagggcctag

DBGET integrated database retrieval system