KEGG   Drosophila erecta: Dere_GG15290Help
Entry
Dere_GG15290      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
der  Drosophila erecta
Pathway
der00562  Inositol phosphate metabolism
der04068  FoxO signaling pathway
der04070  Phosphatidylinositol signaling system
der04140  Autophagy - animal
der04150  mTOR signaling pathway
der04213  Longevity regulating pathway - multiple species
der04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dere_GG15290
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dere_GG15290
   04070 Phosphatidylinositol signaling system
    Dere_GG15290
   04150 mTOR signaling pathway
    Dere_GG15290
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dere_GG15290
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dere_GG15290
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dere_GG15290
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dere_GG15290
Membrane trafficking [BR:der04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dere_GG15290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PI3K_p85B DUF4135
Motif
Other DBs
NCBI-GeneID: 6553598
NCBI-ProteinID: XP_001979405
FlyBase: FBgn0107542
UniProt: B3P349
Position
Unknown
AA seq 1086 aa AA seqDB search
MMDNRSLAYVAHQPKYEQPSEEAGSPCMRFSVNLWKNEMLDWVDLICLLPNGFLLELRVN
PANTIQVIKVEMVNQAKQMPLSYMIKDACEYQVYGISTFNIEPYTDETKRLSEVQPYFGL
LSLGERTDTASFSSDYELTKMVSGMIGATFDHHRTNGSPEIDDFRLYMTQTCDNIELERS
IYTWQQRLLYEHPLRLANSPKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTPFS
LTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQETLSDSAVPNVVL
QSVYRLESYINHHNEQAMVPKRPPPKKQPTPLQKALPSLWDMGNYFQLTLHSISNVNYDK
TRAFNVGVHVCLYHGDQKLCAQRSTDSPNNNFDTFLFNDLVMDFDIQMRNLPRMTRLCIV
IFEVTKMSRSKKSSNNKDSTLKDVSYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYADD
IQSVEVFHPLGTIEPNPRKEECALVDLTFHSSGTGTVRYPSEEVVLHYAAERAQARRLQQ
QQAGPEKPIKELKDLVANYKGLDKIYEMADQDRNAIWERRNDIMRELPEELSILLHCVYW
KERDDVADIWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLLQL
VQAIKHESYLESDLVLFLLERALRNQRIGHYFFWHLRSEMHTPSMQTRFGLLLEVYLKGC
KHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDKRNSGVFQNIQNPLNPSF
RCSGVTPDRCKVMDSKMRPLWVVFENADVNSSDVHIIFKNGDDLRQDMLTLQMLRVMDQL
WKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLK
EHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHF
KEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILSLF
SMMISTGLPELSSEKDLNYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASHNF
SKNNKQ
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgatggacaaccggtcgttggcctacgtggcccaccagccgaagtatgagcaaccgtcg
gaagaggcggggtcgccctgcatgcgcttttcggttaacctgtggaagaacgagatgctg
gactgggtggacctgatctgcctgttgccaaatggattcctgctggagctcagggtcaat
ccggccaacaccatccaggtaatcaaggtggagatggtcaaccaggccaaacagatgcca
ctgagctatatgatcaaagacgcctgcgagtaccaggtgtacggcatctcgacctttaac
atcgagccgtacactgacgaaacgaagcgactcagcgaggtgcagccgtacttcggcctg
ctcagcctgggcgagcgcaccgacacagcgagctttagcagcgactacgagctgaccaag
atggtcagcggaatgataggcgccaccttcgaccatcatcggacgaacggctcgcctgag
atagacgactttcgactgtacatgacccaaacttgcgacaacatcgagctggagcgctcc
atctacacctggcagcagagactgctctacgagcatccgctacggctggccaactcgcca
aagatgcccgagctgatacgagagcggcatccgaccaggaccttcctcatcgtcgtgaag
aacgagaacgaccagagcaccttcacgttgtcggtgaacgagcaggacacacccttctcg
ctaacggagagcacgctacagaagatgaaccggtcgcagatgaaaatgaatgaccggacc
tccgactacatactcaaggtgagcggtcgcgacgagtacctgctcggcgactatccgctg
atccagttcctgtacatccaagagacgctctcggactcggcggttccaaatgtggtgctg
cagtcagtgtaccgccttgagtcctacatcaaccaccacaacgagcaggccatggtgccc
aagcgacctccgccgaagaaacagccaacccccctccagaaggcgctcccttcgctgtgg
gacatgggcaactactttcagctgacgctgcacagcatctccaacgtgaactatgacaag
acgcgcgcctttaatgtgggtgtgcatgtgtgcctatatcacggtgatcagaagctgtgc
gcccagcgatcaacggactcccctaacaacaactttgacacgttcctgtttaatgacctg
gtgatggactttgacatacagatgcgtaacttaccgcggatgacacgcctctgtattgtg
atcttcgaggtgaccaagatgtcgcgctccaagaagtcctccaacaataaggacagcacc
ctgaaagacgtctcctataacaaaaaccccctggcctgggtcaacaccacaatttttgac
cacaaggacatcctgcgtaccggtcgccatacgctgtacacgtggacgtatgctgacgac
attcagtcggtcgaggttttccatccgctgggcaccatcgaacccaatccgcgcaaagag
gaatgtgcgctggtggacctcacattccacagcagcggaaccggaaccgtgcgatatccc
agcgaagaagtcgtcttgcactacgctgcggagcgggcgcaggctagacgactgcaacag
caacaagcaggaccagaaaagccgatcaaagaactgaaggatctggtggccaactataag
gggctggataagatctacgagatggctgaccaggaccgtaatgccatttgggaacgcaga
aacgacattatgcgcgagcttccagaagagctgtccatcttacttcactgcgtctactgg
aaggagcgtgacgacgtagcggacatatggtatctgctgaaacagtggccgcttatttct
atagaacgctcattggagctgctagactacgcctatccagatccggcagtgagacgcttt
gccatccggtgcttacactttctgaaagacgaagacttgctcctgtatctgctgcaattg
gtacaggccatcaagcacgaatcttacctggaaagcgatctggtactttttctgctagag
cgggcactgcgtaaccagcgcatcggccactacttcttctggcacctgcgctctgagatg
cacacgccgtctatgcaaacgcgctttggcctactgctggaggtctacctcaagggttgc
aaacatcacgtagcaccgctgcggaagcagctacatgtgctagaaaagctgaaacaggga
tctctgattgccaagaaaggcagcaaggaaaaggtgaagaccatgctgcaggactttctg
cgggacaagcgcaactcgggggtttttcagaacatccaaaatccactgaatcccagcttc
cggtgcagcggtgtaactccagataggtgcaaggtaatggatagcaagatgcgtccgcta
tgggtggtatttgagaatgctgacgtgaactccagcgatgtgcacatcattttcaagaat
ggcgacgatctccgccaagacatgctcacgttgcagatgctgcgtgtgatggaccagctg
tggaaacgcgatggtatggacttccgcatgaacatctacaactgcatcagcatggagaaa
agcctcggcatgattgaggtggtgcgccacgcagaaaccattgccaacatacagaaggag
aagggcatgttctcggccacgtcgccattcaagaagggctcgctcctcagttggctcaag
gagcataacaagcctgccgacaaactgaacaaagccatcaatgagtttacgctcagctgt
gcgggctattgcgtggccacctatgtgcttggcgtagctgatcggcactcggacaatata
atggtcaaaagaaatggacagctatttcacatcgacttcggccacatcctgggacacttc
aaggaaaagcttggagtacgtcgggaacgagtgccctttgtgttgacccacgatttcgtt
tacgtgatcaacaagggctttaatgaccgggagtctaaagagttttgtcactttcaggaa
ttgtgcgagcgcgcctttttagttttacgaaaacacggctgccttattttatcgctgttc
tcaatgatgatttcaacgggactgccagaactgtcctccgaaaaggatttgaactaccta
cgggaaactttagtgctggactacacggaagaaaaagcacgcgaacatttccgagcgaaa
ttcagcgaggctttggctaactcctggaagacttcccttaactgggcctcgcacaatttc
tccaaaaacaacaaacagtaa

DBGET integrated database retrieval system