KEGG   Drosophila erecta: Dere_GG16226Help
Entry
Dere_GG16226      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06634  cyclin H
Organism
der  Drosophila erecta
Pathway
der03022  Basal transcription factors
der03420  Nucleotide excision repair
Module
der_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dere_GG16226
  Replication and repair
   03420 Nucleotide excision repair
    Dere_GG16226
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dere_GG16226
DNA repair and recombination proteins [BR:der03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dere_GG16226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB Cyclin_C Bcr-Abl_Oligo
Motif
Other DBs
NCBI-GeneID: 6544062
NCBI-ProteinID: XP_001973691
FlyBase: FBgn0108461
UniProt: B3NJ00
Position
Unknown
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMDFRVEQNSKYIESHEEEAQGLDLKEHFLTPAEERLLLKQY
EIYLFDFCRRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGLLIDIKTRSNMQHP
ERLRPHIDSFIDSTFYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDRDKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctctcagaagaggtcatggacgttcgccaacgagggccagctcatg
gacttccgcgtagagcagaacagcaagtacatcgagtcgcacgaggaggaggcgcagggt
ctcgaccttaaagagcacttccttacgcccgcggaggagcgcctgttgctgaagcagtac
gagatctacctcttcgacttctgccgccgcttcgatccgccgatgcccaagtgcgtggtg
ggcacggccttccactacttcaagcggttctatctgaacaacacccccatggactatcat
cccaaggagattctagccacatgcgtgtttgttgcctgcaaagtggaggaattcaacgtg
tccatcaaccagttcgtcaacaacatcaagggcgacaggaataaggccacagacatagtg
ttatccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgaggggcttctaatagatataaaaactcgcagcaatatgcaacatcct
gagcgtctgcggccacatattgatagttttatcgattccacattctactcggatgcctgt
cttttgcatacgccctcgcaaatcgcattagctgccgtcctccacgctgccagcagagaa
caagagaatcttgatagctatgtgacggatcttctttttgtctccgccagggagaagcta
cccggcctcatagatgccgtgagaaaaattcgaataatggtgaagcaatatcagcagccc
gatcgggataaagttaaggccattgagaagaagttggataagtgccgcaatcaagcaaat
aatcctgacagcgaactctataaggagcgcctacgccgattgtacaccgacgaggatgac
atgcctgccgaagatgcctcattccacattgcagacgtgagctcggatacatctgctatg
aacataagccaatag

DBGET integrated database retrieval system