KEGG   Drosophila erecta: Dere_GG17753Help
Entry
Dere_GG17753      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
der  Drosophila erecta
Pathway
der04013  MAPK signaling pathway - fly
der04624  Toll and Imd signaling pathway
Module
der_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG17753
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dere_GG17753
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dere_GG17753
Protein kinases [BR:der01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dere_GG17753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 6551001
NCBI-ProteinID: XP_001978317
FlyBase: FBgn0109975
UniProt: B3NX72
Position
Unknown
AA seq 334 aa AA seqDB search
MSKRHRLAPFTIAKEPEAAIVPPRNLDSRATIQIGDQTFDIDADSLEKICDLGRGAYGIV
EKMRHRQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFRHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGISM
IEMATGRYPYDNWRTPFEQLSQVVEDSPPRLPEGTFSPEFEDFISVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDTQPAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgccaccgcctcgccccctttaccattgccaaggagccagaggccgccata
gtcccgccacgcaacctggactcgcgggccaccatccaaattggcgaccagacctttgac
atcgatgcagatagtctggagaagatctgcgatctgggccgtggcgcctatggcatcgtg
gagaagatgcgccatcggcaaaccgatacggtcctcgccgtcaaacgcatacccatgacc
gtaaatatccgagaacagcaccgccttgtgatggatttggacatatcgatgagatccagc
gactgcccctacaccgtccacttctatggagcgatgtaccgcgagggagatgtctggatc
tgcatggaggtgatgagcaccagcctggacaagttctatccgaaggtcttccgccacgat
ctgcgaatggaggaaagcgtgctgggcaagattgcaatgagcgtggtcagtgcgctgcac
tacctgcacgctcaactgaaagtcatccatcgcgacgtcaagccctcgaacatactgatc
aatcgggccggacaggtcaagatctgtgactttggcatctcaggctacctcgtggactcc
attgccaaaactatcgatgccggttgcaagccgtacatggcgccggaacgcatcgatccc
cagggaaatccggcgcaatacgacatcaggtcggatgtttggtcgctgggcatcagcatg
atcgaaatggccactggccgctacccttacgacaactggcgaacgccatttgagcaactg
agtcaggtggttgaggacagtccgccgcgcctgccggagggaaccttttcgccggagttc
gaggacttcatctccgtctgcctgcaaaaggagtacatggcgcggcccaactacgagcag
ctgctcaagcacagcttcatcgtggagcacctgcagcgcaacacggacatctcggagttc
gtggccaggatactggatctgcccgacacccagccggcgcagtag

DBGET integrated database retrieval system