KEGG   Drosophila erecta: Dere_GG18067Help
Entry
Dere_GG18067      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
der  Drosophila erecta
Pathway
der00020  Citrate cycle (TCA cycle)
der00310  Lysine degradation
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00009  Citrate cycle (TCA cycle, Krebs cycle)
der_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dere_GG18067
  Amino acid metabolism
   00310 Lysine degradation
    Dere_GG18067
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dere_GG18067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 NQRA IL3
Motif
Other DBs
NCBI-GeneID: 6551808
NCBI-ProteinID: XP_001980577
FlyBase: FBgn0110284
UniProt: B3NZG2
Position
Unknown
AA seq 469 aa AA seqDB search
MTGIISIVTRRLPQTLGMRALRSNELKRCIRQYSRLVACAAQQQQLFRQDGSNRCQEATR
LLTWQGIHTTSSMWSEQTINVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVA
VPAPFAGTLTDILVKDGDTVKPGQALFKIKPGAAPAKAAAPAAAAPAPAAPKAAPAPAAA
AKPAPPPPAAGAPKPPPPPPPKAAPRPAPPAPVASLKPAVAQVKVPPADGSRQILGTRSE
QRVKMNRMRQKIAARLKDAQNTCAMLTTFNEIDMSYAMDFRKQNLDAFTKKYGIKLGFMS
IFAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIE
IALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFERPI
AVKGEVKVRPMMYIALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttcgatcgtaacgagacggctgccccaaacgctgggaatgcgagcc
ctgcggagtaatgagctgaagcgctgcatccgccaatactcacggttagttgcctgtgcc
gcgcagcagcaacaactgttccgccaagatggctccaatcgctgccaggaggccaccagg
cttctcacctggcagggtatccacaccacgtcgagcatgtggtcggagcagaccatcaat
gtgccaccctttgcggactccatcgccgagggtgacatcaagtttacttgcaaggtgggt
gattcattcgccgctgacgaggccgtcatggaaatcgagaccgacaagacgacagtggct
gtgccagctccctttgccggtactctgaccgacattctggtgaaggatggcgacaccgtc
aagcccggacaggctctgttcaaaattaagcccggtgcagcgcccgccaaggcagctgct
ccagcggctgctgcacccgctcctgctgcccccaaagcagccccagctcccgctgctgca
gccaagccggctcccccaccaccagccgccggcgcacctaagccaccaccaccgccacca
ccaaaggcagcccctcgaccagcaccacctgctccagtggcctcgctcaagccggccgtc
gcccaggtgaaggtgccaccagcggacggatcgcggcaaatcctaggcacaaggtccgag
caacgtgtcaagatgaaccgcatgcgtcagaagattgccgcccgcttgaaggatgcccaa
aacacatgtgctatgctcaccacttttaacgagatcgatatgagctatgccatggacttc
cgtaagcagaatttggatgcgtttactaagaagtatggcattaagcttggctttatgtcc
atctttgcgaaggctagtgcctatgcgctgcaggatcagcccgtagtgaacgccgtcatc
gatggcacggacatcgtgtaccgcgactacgttgatatctctgtggccgtggctacgcct
cgtgggttggtggtaccggtcatccgaaacgtggagggcatgaactatgcggatatcgag
atcgcgctggccggtttggccgacaaggcaaggcgggatgccatcaccgtggaggacatg
gacggcggcaccttcaccatcagcaatggaggagtgtttggatccctgatgggcacgccc
atcatcaatccgccacagagtgccattcttggtatgcacggcatctttgagcgaccaatt
gctgtcaagggcgaggtcaaggtacgaccaatgatgtacatcgccctgacctacgatcac
cgaatcattgatggacgtgaggcggtcctgttcctgcgaaaaataaaggctgctgtagag
aacccagcaatcattgttgccggattgtaa

DBGET integrated database retrieval system