KEGG   Drosophila erecta: Dere_GG18305Help
Entry
Dere_GG18305      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
der  Drosophila erecta
Pathway
der04013  MAPK signaling pathway - fly
der04068  FoxO signaling pathway
der04140  Autophagy - animal
der04150  mTOR signaling pathway
der04320  Dorso-ventral axis formation
Module
der_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG18305
   04068 FoxO signaling pathway
    Dere_GG18305
   04150 mTOR signaling pathway
    Dere_GG18305
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dere_GG18305
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dere_GG18305
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dere_GG18305
Protein kinases [BR:der01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dere_GG18305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 6549818
NCBI-ProteinID: XP_001977341
FlyBase: FBgn0110521
UniProt: B3NT88
Position
Unknown
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccgtttaaaaccccctcgggcacagacacacacagt
ttgctggggaagcctaagacgagcatcgatgcgctgacagagacgctggagggcctggac
atggacgacacggaacgcaaaaggatcaaggtgtttctcagccagaaggagaagatcggc
gagctgtcggacgaggatctggagaagctgggcgaactgggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaacttatccatctg
gaggtgaagccggcgattaagaaacagatcctgcgcgaactgaaagtattgcacgaatgt
aatttcccacacattgtcggtttctatggcgccttctacagcgacggcgagatcagtata
tgcatggagtatatggacgggggatcgcttgatctgatcctcaagcgggccggtcgaata
ccggagtccattctcggcaggatcacgctggcagtactcaagggattgagctacctgcgc
gacaagcacgccatcattcaccgtgacgtgaagccaagcaatatccttgtcaacagtagc
ggtgagatcaagatctgtgatttcggcgtctccggccaactaatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcacccactactcc
gtgcagtcggacatctggtcgttgggcctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaataccgccaccctggagtcgatattcgcggacaatgcagaggag
agcggccagccgacggacgagcctagggcaatggccatcttcgagctgctggattacatt
gtgaacgaaccgccgcccaagctggagcacaagatattctccaccgagttcaaagacttt
gtggacatctgcctgaagaaacagcccgacgagcgggccgatctcaagaccctgctgagt
catccatggatacgcaaggcggaagtggaggaggtggatatatccggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system