KEGG   Drosophila erecta: Dere_GG18564Help
Entry
Dere_GG18564      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
der  Drosophila erecta
Pathway
der00052  Galactose metabolism
der00511  Other glycan degradation
der00531  Glycosaminoglycan degradation
der00600  Sphingolipid metabolism
der00604  Glycosphingolipid biosynthesis - ganglio series
der01100  Metabolic pathways
der04142  Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dere_GG18564
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dere_GG18564
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dere_GG18564
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dere_GG18564
   00511 Other glycan degradation
    Dere_GG18564
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG18564
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dere_GG18564
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG18564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-GeneID: 6553840
NCBI-ProteinID: XP_001980479
FlyBase: FBgn0110775
UniProt: B3P1H8
Position
Unknown
AA seq 637 aa AA seqDB search
MKFSMVVLVGLLPLLGAASENRTFAVDYDKDQFLKDGEPFRFIAGSFHYFRAHPATWQRH
LRTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLERFIRLAVGEDLLVILRPGPYICA
ERDMGGFPYWLLNKYPGIQLRTADVNYLSEVRIWYTQLFAKMNQYLYGNGGPIIMVQVEN
EYGSFFACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIHGVLATMDFGATNDLK
PIWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITTTFINMLDHGASVNFYMFY
GGTNFGFTAGANEIGPGNYMADITSYDYDAPMTEAGDPTTKYQALRRIIGRYLPLPNQPV
PGPVPKRSYGTVRLTICCSLLSPEARTRLSTGFVQSAKPKSFEALGQYSGLVLYETWLPS
FQRDPSILSVPGLADRGYVYVDGEFVGILARETPVFELPLSASAGRRLQIIVENQGRINY
GRQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDSLEQLITRSNEAARQGFQELKKLRT
MLRTGPTIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPA
PVLKVGSNRLVVVEYQQTPTSQELHFRDTPILNARTV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagcatggtggtcctggtgggtctactgccgctgctgggagctgcttcagag
aatcgcactttcgcagtggactacgataaggatcagttcttaaaggatggagaaccattc
agattcattgccggctccttccactacttccgtgcccatccagccacctggcagaggcat
cttaggacaatgagagccgcgggtctgaatgcggtgaccacttatgtggagtggtcattg
cacaatccgcgggatggcgtttatgtttggagtggcattgccgatctggagcgctttata
cgcctggccgtgggcgaggatctgctggtcatcctccgtccgggtccgtatatttgtgcg
gagcgtgacatgggcggctttccctactggctgctcaataagtatccggggattcaactc
cggacagcagacgtcaattatctaagcgaagttcgcatttggtatacccaactgtttgcc
aagatgaaccaatatctgtacggcaatggggggccaatcatcatggttcaggtggagaac
gaatatggctccttctttgcctgcgatctcaactatcggaattggcttcgcgatgagacc
gagagtcatgtcaaaggtcaggcggtgctcttcaccaatgatggacccagtgtgctgcgc
tgtggcaaaatccatggagtcctggcgaccatggactttggagccacgaacgatcttaag
cccatttgggccaagcttagaaggtaccagccgaagggtccgctggtcaatgcggaatac
tatcccggctggctaacccactggacggagccgatggccaatgttagcacccaatcgatt
actaccacttttataaacatgctggatcatggtgccagtgtgaacttctacatgttctac
ggcggcactaacttcggatttacagctggtgccaatgaaattggacccggaaactacatg
gcggacatcaccagctacgattacgatgcgcccatgacggaggcgggagatcccactacc
aagtaccaggccctgcgacgcatcattggccgctatctcccgctgccaaatcaacccgtg
cccggacccgttcccaagcgatcctacggcactgtgcgtctgaccatctgctgtagtctg
ctttcgccggaggcgcgtactcgtctctccactggctttgtgcagtccgccaagccgaag
agcttcgaggctctggggcagtattctgggttggtgctctacgagacctggctgcccagt
ttccagcgggatcctagcatcctgagcgttcccggactggcggatcgaggttacgtttat
gtggatggagagtttgtgggtattttggccagggaaacacccgtattcgaattgcccctt
agtgccagtgccggacggaggctgcagatcatcgttgagaaccagggtcgcatcaactac
ggtcgccagctgaacgactttaagggcatcctgcgggatgtgcgactggacaagcaggtg
ctgagcaactggaacatgacccaattccccctcgagtcgtacgacagcctggagcagctg
attacccggtcgaatgaggctgcccgtcagggcttccaggagctaaagaagttgcgcaca
atgctgcgcactggtcccaccatctaccacggccaactggacatccagaaggagtcggac
ctggcagacacctatctggacatgtccggctggggcaagggcattgtctttgtgaatggc
gaaaatctcggcaggtactggccactggtgggacctcaggtcaccctgtatgttccggcg
cccgtgctcaaggtgggctcaaaccgactggtggtggtggagtaccagcagacacccacc
tcacaggagctgcacttccgggacacccccatactgaacgcgagaaccgtttag

DBGET integrated database retrieval system