KEGG   Desulfuromonas soudanensis: DSOUD_0651Help
Entry
DSOUD_0651        CDS       T04049                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
des  Desulfuromonas soudanensis
Pathway
des00471  D-Glutamine and D-glutamate metabolism
des01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:des00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DSOUD_0651 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:des01011]
    DSOUD_0651 (murI)
Enzymes [BR:des01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DSOUD_0651 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:des01011]
 Precursor biosynthesis
  Racemase
   DSOUD_0651 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ALC15439
UniProt: A0A0M3QF16
Position
740337..741176
Genome map
AA seq 279 aa AA seqDB search
MSERAIGIFDSGVGGLTVFKEIHRLFPGEELLYLGDTARVPYGTKSPGTVLRYALEAAAF
LVDQRVKMLVVACNTASSVALEALAERFSLPVLGVIAPGARKAVSVTRNCRIGVIGTEGT
VKSGAYTRAIHALAPEVEVFAAPCPLFVPLAEEGWSDHPVARLAAEEYLEPLMARGIDTL
VLGCTHYPLLKKTLGAILGDGVTLVDSAEETANEVAGVLARDDLARRGPLLPPRFFVTDV
PTRFERVGGAFLGTPLCGVDRVEIDGALFHPLDDSLRRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagagggcgatcggaatattcgattctggggtcggcggcctgacggtgttcaag
gaaatccaccggctttttcccggagaagagctgctctatctcggggataccgcccgggtt
ccctacgggaccaaaagccccgggacggtgctgcgttacgccctcgaggcggccgccttt
ctcgtcgatcagcgggtgaagatgctggtggtcgcctgtaataccgcctcatccgtggcc
ctcgaggccctggccgagcgtttcagcctgccggttctcggggttatcgcccccggtgcc
cgcaaggctgtttccgtgacccgcaattgccgcatcggcgtcatcggcacggaggggacg
gtaaaaagcggcgcctatacccgcgccattcatgccctggcaccggaggtcgaggtcttt
gccgcaccctgcccactcttcgtccctctggccgaggaagggtggtccgaccaccccgtc
gcccgcctggcggccgaggaatacctggagccgctcatggcccgggggattgataccctg
gtcctcggctgcacccactatcccctgctgaagaagaccctcggcgcgattctcggcgac
ggtgtgaccctggtcgattccgccgaggagaccgccaacgaggtcgccggggttctggca
cgggacgacctggcgcggcgcggtccgctcctccccccgcgattttttgtcaccgatgta
ccgacccgtttcgaacgcgtcggcggcgccttcctcggcacccccctctgcggggtggac
cgggtggagatcgacggtgccctgttccatcccctcgacgattccctgcggcgccgctga

DBGET integrated database retrieval system