KEGG   Desulfuromonas soudanensis: DSOUD_2896Help
Entry
DSOUD_2896        CDS       T04049                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
des  Desulfuromonas soudanensis
Pathway
des00071  Fatty acid degradation
des00072  Synthesis and degradation of ketone bodies
des00280  Valine, leucine and isoleucine degradation
des00310  Lysine degradation
des00362  Benzoate degradation
des00380  Tryptophan metabolism
des00620  Pyruvate metabolism
des00630  Glyoxylate and dicarboxylate metabolism
des00640  Propanoate metabolism
des00650  Butanoate metabolism
des00900  Terpenoid backbone biosynthesis
des01100  Metabolic pathways
des01110  Biosynthesis of secondary metabolites
des01120  Microbial metabolism in diverse environments
des01130  Biosynthesis of antibiotics
des01200  Carbon metabolism
des01212  Fatty acid metabolism
des02020  Two-component system
Brite
KEGG Orthology (KO) [BR:des00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSOUD_2896
   00630 Glyoxylate and dicarboxylate metabolism
    DSOUD_2896
   00640 Propanoate metabolism
    DSOUD_2896
   00650 Butanoate metabolism
    DSOUD_2896
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DSOUD_2896
   00072 Synthesis and degradation of ketone bodies
    DSOUD_2896
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSOUD_2896
   00310 Lysine degradation
    DSOUD_2896
   00380 Tryptophan metabolism
    DSOUD_2896
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSOUD_2896
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DSOUD_2896
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSOUD_2896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:des04147]
    DSOUD_2896
Enzymes [BR:des01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DSOUD_2896
Exosome [BR:des04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSOUD_2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DUF1598
Motif
Other DBs
NCBI-ProteinID: ALC17626
UniProt: A0A0M4D4K1
Position
complement(3159487..3160779)
Genome map
AA seq 430 aa AA seqDB search
MRPVYMIAGGITKFAKALPEKDFRLMVKEAFDYALADVPALRRQDIDGSVCSYFSDHFTR
QLMAGAMVQDYLGLNPKPSRRIEGGGATGGLCFQSGWEAVASGRMEVSLALGFETMSRVN
TWKGNEFIALASDTNFDYPVGGFYTGYYAMMVRRHMHEFGTTVEQMARVAVKNHVNALHN
PYAQRPGRLTIEDVRSSPMVATPLTILDCCQMSDGAAVAILVSEEMAQKLGVQPVRITGV
GCGTDAMRMADRPHGKVPLLPHENEADYADLKYPGVHSFRGGRTAAALAYRMAGIADPGR
DLDFVELHDAYTSSEIQTYEDLGLCRYGEGGSFVDSGAPFLSNLDYGLEFAADGRWPRLP
VNPSGGLLACGHPVGATGLMQAVFAFWQLQGTIARHLGDPTLQLPDPKRGLIHSHAGTGT
YVTVSILERG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcggccggtctatatgattgcaggcggtatcaccaagttcgccaaggcgctcccggag
aaggacttccgcctcatggtgaaggaagccttcgactatgcccttgcggacgtcccggct
ctgcgccggcaggatatcgacggcagcgtctgctcctatttttccgaccacttcacccgc
cagctcatggccggggcgatggtccaggattacctggggctcaatcccaaaccgtcccgc
cgcatcgaggggggaggggcgacgggcggactctgcttccagtcggggtgggaagcggtg
gcctccgggcggatggaggtctccctggccctggggttcgagacgatgagccgggtcaac
acctggaaggggaacgagttcatcgccctggcctcggacaccaacttcgactacccggtc
ggcgggttctacaccggttattacgccatgatggtgcggcgccacatgcacgagttcggc
accaccgtcgagcagatggcccgggtggcggtcaagaaccacgtcaacgccctccacaac
ccctacgcgcagagaccgggccggctcaccatcgaggacgtccgctcctcgcccatggtc
gccacccccctcaccatcctcgattgctgccagatgtccgacggcgccgccgtggcgatc
ctcgtctccgaggagatggcgcagaagctgggggtgcaaccggtgaggatcaccggcgtc
ggctgcggcaccgacgccatgcgcatggccgaccgcccccacgggaaggtcccgctcctc
ccccacgagaacgaagcggactacgccgatctgaaatacccgggggtccactccttccgg
ggcgggcggacggcggcggcgctggcctaccgcatggcagggattgccgatccgggccgg
gacctcgacttcgtcgaactccacgacgcctacacctcctccgagatccagacctatgaa
gacctcgggctctgccggtacggggaaggggggagcttcgtcgactccggagcgcccttt
ttgtccaaccttgactacggcctggaatttgccgccgacgggcgctggccgcgcctcccc
gtcaacccctccggtggcctcctcgcctgcggccacccggtgggagccacggggctgatg
caggccgtcttcgccttctggcagctgcaggggacgatcgcccggcatctgggggacccg
accctgcagctccccgacccgaaacgggggctgatccacagccacgccgggacggggacg
tatgttacggtgtcgattctggagaggggttga

DBGET integrated database retrieval system