KEGG   Dehalococcoides mccartyi 195: DET0583Help
Entry
DET0583           CDS       T00223                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
det  Dehalococcoides mccartyi 195
Pathway
det03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:det00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DET0583 (recR)
DNA repair and recombination proteins [BR:det03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     DET0583 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DET0583 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH Prok-RING_4 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AAW40139
UniProt: Q3Z8X4
Position
complement(535094..535708)
Genome map
AA seq 204 aa AA seqDB search
MKDTSLPSTAGAVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEEQVLTLSDTIRSIKNQI
SQCRICFNVADSELCPICQNTKREANKICVVEQPQDILALEHVGVYRGYYHVLHGAISPT
EGITSQNIRINELMSRLNDGQVDEVILATNPTTEGEATAMYLSRLITPLGIKVTRLARGL
PFGTELEYADDVTLSRAMEGRQNF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggatacttctttaccgtctacagccggtgcagtaaacaagcttatagattcgctg
ggcaaactcccgggcataggcccgaaaagcgcccagcggctggctttttacctgatgagg
gcgcctgaagaacaggttctgactctttcagatactatccgcagtatcaagaaccagata
agccagtgccgtatctgctttaacgtggctgacagtgagctttgcccaatctgccagaat
accaaacgcgaagcaaacaagatttgcgtggtggaacagccgcaggatattttggcactg
gaacacgtgggcgtttaccgaggctattaccatgtactgcacggggctatctcccccacc
gaaggcatcacttcccaaaatatacgcatcaacgaacttatgagccgcctgaatgacggg
caggtagatgaggttattttagctaccaaccccaccaccgagggtgaggctaccgctatg
tacctttcgcgcctgataaccccgctgggtataaaagtaaccagactggcacggggttta
ccctttggaaccgaactggaatatgctgatgatgtaaccttaagccgggccatggaggga
cgccagaacttttag

DBGET integrated database retrieval system