KEGG   Dehalococcoides mccartyi 195: DET0814
Entry
DET0814           CDS       T00223                                 
Name
(GenBank) ABC transporter, permease protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
det  Dehalococcoides mccartyi 195
Brite
KEGG Orthology (KO) [BR:det00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:det02000]
    DET0814
Transporters [BR:det02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    DET0814
SSDB
Motif
Pfam: ABC2_membrane ABC2_membrane_3 ABC2_membrane_2 ABC2_membrane_4 CcmB ABC2_membrane_5
Other DBs
NCBI-ProteinID: AAW39958
UniProt: Q3Z8A7
Position
744263..744988
AA seq 241 aa
MNNILAIAQRLIRQLLHDRRTMALIIVVPVVVMGLIGVSFPDATVLDYIAPAMLATLALF
FSFLLTGISFLRETSQGTMERLMAAPVSRLDIVAGYLLGFFVFALLQTLIIVLFTIYVLG
VNFQGELWQILLFQVLIITGAVTLGIFTSSFAKNEFQMVQFIPLIIVPQVFLCGVIWPVS
QMPEWLQYLSNILPLTYGVDGMREIMLQGKNLAEVGFQCGVLILFAVITTALAALTVPKR
R
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaataatatactggctattgcccagaggcttatccgccagttgctccatgaccggcgg
actatggcccttattatagtagtcccggtggtggttatggggcttataggggtaagtttc
ccggatgccactgtacttgattatattgccccggccatgctggccactttagccctgttt
ttcagcttcctgctgaccggcatttcattccttagggagacatctcaggggactatggaa
aggcttatggcggcacctgtttcccgtctggacatagttgccggttatctgctggggttt
ttcgtgtttgccctgctccagacacttatcattgttctttttactatctacgtgctggga
gtcaactttcagggtgaactctggcagattctgctctttcaggtgcttattattaccggg
gcggttacactgggcattttcaccagcagttttgccaaaaatgaatttcaaatggttcag
tttatccctcttattattgtcccccaggtgtttttgtgcggtgttatctggccggtttcc
caaatgccggaatggcttcagtacctgtcaaatatactgccgctgacctatggcgtggac
ggcatgcgggaaataatgcttcaggggaaaaatctggctgaagtaggctttcagtgcggg
gttctgatattgtttgcagttattaccaccgctttggcggcactcaccgttcccaagcgc
cgctaa

DBGET integrated database retrieval system