KEGG   Dehalococcoides mccartyi 195: DET1208Help
Entry
DET1208           CDS       T00223                                 

Definition
(GenBank) nucleotidyltransferase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00051  Fructose and mannose metabolism
det00520  Amino sugar and nucleotide sugar metabolism
det01100  Metabolic pathways
det01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:det00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DET1208
   00520 Amino sugar and nucleotide sugar metabolism
    DET1208
Enzymes [BR:det01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DET1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AAW39530
UniProt: Q3Z778
Position
1106216..1107301
Genome map
AA seq 361 aa AA seqDB search
MKAIILVGGQGTRLRPLSINTPKSMVPVLNVPFLSHVLRYLSSCGIKDIILTQGHLAAPI
EQYFGNGQSLGVNLVYSVEHEALGTAGAIKNAERYLDDTFITLNGDIFTHLDLSAMLRAH
RDKKALVSIALTPVDDPTKYGLVETADGGRVSRFLEKPSPAQITTNMINAGTYIIEPEVL
KYIPAGENHSFERQLFPRLLNECQAVYAYPSSAYWIDIGSPEKYSQLNRDLLCGEGGDFG
FSRGNEIVIGRGCQLHPTARISGPVLVGENCIIGANACIAGPVVIGAECRIEDEATLTES
VIWQNVTIGAECKVVSSIIANHCHLKAGGKYENVVLGDNVTAECGCAPEPGSKISPGILM
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattattctggtcggcgggcagggcacaaggcttcggccgctaagtataaac
acgcccaaatccatggttccggtacttaacgtacctttcttaagccatgttttgcgttac
ctgtcttcctgcggcatcaaagatattatccttacccaggggcatctggccgcccccatt
gagcagtatttcggcaatggccaaagcctgggtgtaaacctggtatattcggttgaacac
gaggctttaggcacagccggggctatcaaaaatgccgaacgctaccttgatgacactttc
attactttgaacggggatatatttacccatctggatttgtctgccatgctgcgcgcccac
cgggataaaaaagcgctggtcagcatagccctgacaccggtagatgaccccaccaaatac
gggctggttgaaaccgcagacggcggcagggtaagccgctttctggaaaagccttcaccc
gcccagataacaaccaacatgataaatgccggcacgtatatcattgagcccgaagtactc
aaatacatacctgcgggtgaaaaccacagctttgaaagacagcttttcccccgcctgctg
aatgaatgtcaggcggtttatgcctacccgtccagtgcgtactggatagacattggcagc
cccgaaaaatactcccagctaaacagggatttactctgcggcgagggcggagattttggt
ttcagccggggtaatgagatagtcattggccgcggttgccagcttcaccccacagcccga
atcagcgggccggtactggtgggagaaaactgcattataggcgcaaatgcctgtattgca
gggccagtagttatcggcgcggaatgccggattgaagatgaggctacccttaccgaatct
gttatctggcaaaatgtgaccataggagccgaatgcaaagttgtttcgtccatcattgcc
aatcattgccacctgaaggcaggcggcaaatatgagaatgtggtgttgggagacaatgtg
accgccgaatgcggttgcgcgccggaacccggcagcaaaatcagcccgggtatccttatg
atctaa

DBGET integrated database retrieval system