KEGG   Desulfuromonas sp. DDH964: DBW_0044Help
Entry
DBW_0044          CDS       T04368                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
deu00071  Fatty acid degradation
deu00072  Synthesis and degradation of ketone bodies
deu00280  Valine, leucine and isoleucine degradation
deu00310  Lysine degradation
deu00362  Benzoate degradation
deu00380  Tryptophan metabolism
deu00620  Pyruvate metabolism
deu00630  Glyoxylate and dicarboxylate metabolism
deu00640  Propanoate metabolism
deu00650  Butanoate metabolism
deu00900  Terpenoid backbone biosynthesis
deu01100  Metabolic pathways
deu01110  Biosynthesis of secondary metabolites
deu01120  Microbial metabolism in diverse environments
deu01130  Biosynthesis of antibiotics
deu01200  Carbon metabolism
deu01212  Fatty acid metabolism
deu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:deu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DBW_0044 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    DBW_0044 (thlA)
   00640 Propanoate metabolism
    DBW_0044 (thlA)
   00650 Butanoate metabolism
    DBW_0044 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DBW_0044 (thlA)
   00072 Synthesis and degradation of ketone bodies
    DBW_0044 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DBW_0044 (thlA)
   00310 Lysine degradation
    DBW_0044 (thlA)
   00380 Tryptophan metabolism
    DBW_0044 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DBW_0044 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DBW_0044 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DBW_0044 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:deu04147]
    DBW_0044 (thlA)
Enzymes [BR:deu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DBW_0044 (thlA)
Exosome [BR:deu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DBW_0044 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMV70445
UniProt: A0A143B2A8
Position
49555..50730
Genome map
AA seq 391 aa AA seqDB search
MSDVFVVEALRTPFGSFGGVLADVPAPRLGAAVVAALVARCGIQPADVQEFIAGQVISGG
CGQAPARQAMRFAGLPDGIPAMTINKVCGSGLKAMMLAADSIRLGESGVVIAGGMENMSL
APYALPAARYGMRMGNGEAVDLLIHDALRDPYTGRHMGEVTEDVIAAKGLSRAAQDEYAL
DSYRRAQKAQRDGVFAREIVPVVKQGRKGETVVDSDEEPARVDFDKFAGLKAVFRKEGSI
TAGNASTINDGAAFVLLAGEEAVKRHGFKPRARLVAYATNSLHPDQFPVAPIGAIERVCA
KAGLKPAELDLFEINEAFAAVALLAIDSLKLDRERVNIHGGAVAIGHPVGASGGRLVATL
LNGLERRQKRYGLATLCIGGGEAVAAIFERL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgttttcgtagttgaagccctgcgcacccccttcggctctttcggtggcgtg
cttgccgatgtcccggcgccgcgcctcggtgccgccgtggtcgccgcgctggtcgcgcgc
tgcggtatccagcccgccgatgttcaggaattcatcgccggccaggtgatctccggcggc
tgcggccaggccccggcgcgccaggcgatgcgcttcgccggcctccccgacggcatcccg
gcgatgaccatcaacaaggtctgcggcagtggcctgaaagcgatgatgcttgccgccgat
tcgatccgcctcggcgagagcggcgtcgtcatcgccggcggcatggagaatatgtcgctc
gccccctacgccctgccggcggcccgttacggcatgcgcatggggaatggcgaggcggtc
gacctgctgatccacgacgccctgcgcgatccttacactggccgccacatgggggaggtg
accgaggatgtcattgccgccaaggggctcagccgcgccgcccaggacgagtacgccctc
gactcctatcgccgcgcgcaaaaggcgcagcgcgacggcgtcttcgcccgcgagatcgtg
ccggtggtcaagcaggggcgcaagggggagacggtggtcgacagcgacgaggagccggcg
cgggtcgatttcgacaagttcgccggtctcaaggcggtcttccgcaaggaggggagtatt
accgccggtaacgcctcgaccatcaacgacggcgccgccttcgtcctcctcgccggggag
gaggcagtcaagcgccacggcttcaaaccccgcgcccgtctcgtcgcctacgccaccaac
agcctgcatcccgaccagttcccggtggcgccgatcggcgccatcgagcgggtctgcgcc
aaggccgggttgaaaccggccgagctcgacctgttcgagatcaacgaggctttcgctgcg
gtcgccctgctggcgatcgacagcctgaagctcgatcgcgagcgggtcaacatccacggc
ggcgccgtcgccatcggccacccggtcggcgccagcggcggacggctggtcgccaccctg
ctcaacggcctcgaacggcggcaaaaacgctacggcctcgccaccctctgcatcggcggc
ggtgaggcggtggcggcgatcttcgaacgactttaa

DBGET integrated database retrieval system