KEGG   Desulfuromonas sp. DDH964: DBW_2870Help
Entry
DBW_2870          CDS       T04368                                 

Gene name
fda
Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
deu00010  Glycolysis / Gluconeogenesis
deu00030  Pentose phosphate pathway
deu00051  Fructose and mannose metabolism
deu00680  Methane metabolism
deu01100  Metabolic pathways
deu01110  Biosynthesis of secondary metabolites
deu01120  Microbial metabolism in diverse environments
deu01130  Biosynthesis of antibiotics
deu01200  Carbon metabolism
deu01230  Biosynthesis of amino acids
Module
deu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
deu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:deu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DBW_2870 (fda)
   00030 Pentose phosphate pathway
    DBW_2870 (fda)
   00051 Fructose and mannose metabolism
    DBW_2870 (fda)
  09102 Energy metabolism
   00680 Methane metabolism
    DBW_2870 (fda)
Enzymes [BR:deu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DBW_2870 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MraZ DUF4131
Motif
Other DBs
NCBI-ProteinID: AMV73179
UniProt: A0A143BAW6
Position
complement(3044698..3045678)
Genome map
AA seq 326 aa AA seqDB search
MGDAVHFTELGLVNTREMFRRAVGGGYAIPAYNFNNLEQLQAIITACAETASPVIVQVSK
GARDYANQTMLRFMAMGAVQMAREQGSHIPIALHLDHGDTFEVCKSCVDSGFSSVMIDGS
HLPFAENVALTRQVVEYAHRFDVTVEGELGVLAGIEDEVSAEHSTYTKPEEVEEFVKQTG
VDSLAISIGTSHGAYKFKLKEGEEVPPLRFDILAECEKRLPGFPIVLHGASSVVQEYVEL
INAFGGRMDGAVGVPEEQLRRAAASAVCKINIDSDGRLAVTARVREYLAKNPGEFDPRKY
LGAARKELVKLIKHKNEAVLGSAGKA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgcagtgcacttcaccgagctcgggctggtcaacactcgtgagatgttccgc
cgggccgtgggcggcggttatgccatcccggcctacaacttcaacaacctcgaacagctg
caggcgatcatcaccgcctgtgccgaaaccgcctcgccggtcatcgttcaggtcagcaag
ggcgcccgcgactacgccaatcagacgatgctgcgcttcatggcaatgggagcggtgcag
atggcccgggagcagggctcccatatccccattgccctccatctcgatcatggcgatacc
tttgaggtttgcaagtcttgcgtcgattcgggattctcctcggtgatgatcgacggttcc
cacctccccttcgcggagaatgtcgccctgacccgccaggtcgtcgagtatgcccatcgc
ttcgatgtcaccgtcgaaggggagctcggcgtgctcgccggcatcgaggatgaggtctcc
gccgagcattcgacctataccaagccggaggaggtcgaggagttcgtcaagcagaccggc
gtcgactccctcgccatctccatcggcaccagccacggcgcctacaagttcaagctcaag
gagggggaggaagtcccgccgctgcgcttcgatatcctcgccgagtgtgaaaagcgtctc
cccggcttcccgatcgtcctccatggcgcctccagcgtggtccaggagtatgtcgagctg
atcaacgcctttggcggcaggatggacggcgccgtcggcgtccccgaggagcagctgcgc
cgcgccgcggcgagcgccgtctgcaagatcaacatcgattccgatggccgtctggccgtc
accgcccgggtgcgcgaatacctcgccaagaaccccggcgagtttgacccccgcaagtat
ctcggcgccgcccgcaaggagctggtcaagttgatcaagcacaagaacgaggccgtcctc
ggcagcgccggcaaggcctga

DBGET integrated database retrieval system