KEGG   Desulfuromonas sp. DDH964: DBW_2912Help
Entry
DBW_2912          CDS       T04368                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
deu00310  Lysine degradation
deu01100  Metabolic pathways
deu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:deu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    DBW_2912 (lhgO)
Enzymes [BR:deu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     DBW_2912 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Mqo Lycopene_cycl Pyr_redox_2 FAD_binding_2 HI0933_like Pyr_redox Thi4 Amino_oxidase NAD_binding_9 FAD_oxidored Trp_halogenase GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMV73221
UniProt: A0A143BAP0
Position
complement(3084899..3086128)
Genome map
AA seq 409 aa AA seqDB search
MTKNSVPADAIADVVVIGGGILGCATAAALLERAPGLKVLLLEKEPQLAAHQTGHNSGVI
HSGLYYRPGSLKATNCSSGRVALYAFCAAEGIAHERCGKLVVAGSEEELPLLDELERRGR
ANGLEGILRLDESGLHDHEPEVAGLAGLFVPQTGIVDYVAVTEALARRVQQGGGEVRLCS
EVQSIRRDGDHFRLGTPGGSVLARQIVNCAGLQCDRVAVLAGLRPGVRIVPFRGEYYLLR
PAARSLVRNLIYPVPDPAFPFLGVHFTRMIDGRVEAGPNAVLAFRREGYDRLSWSLRDSL
ATFTYPGFWHLAARYWDKGLGEFQRSFSKGLFVRDLQRLIPALREEDVERGGAGVRAQAI
AADGSLLDDFHILEGEGMVHLLNAPSPAATASLSIGATVADTTLKQLQG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaaatagcgttccggccgacgccatcgccgatgtcgtcgtgattggcggcggt
atcctcggctgcgcgacggcggcggctctcctggaacgggcgccgggcctgaaggttctg
ctgctcgagaaggagccgcagctggccgcccaccagaccggccataacagcggagtcatt
cactccgggctctattaccgcccgggctcgctcaaagccaccaattgcagctccggacgg
gttgccctctacgccttttgtgccgccgaggggatagcccacgagcgctgtggcaaactg
gtggttgccggcagcgaggaagagcttcccctcctcgatgaactggagcggcgcggccgg
gccaatggcctggaaggaatcctgcgtctcgatgagtccggtctgcatgaccatgaaccg
gaggtcgccgggctcgccggtctttttgtcccccagaccggaatcgtcgactatgtcgcg
gtgaccgaagccctggcgcgccgggtgcagcaggggggcggggaggtgcgcctttgcagc
gaggtgcagagcatccgccgggatggggatcatttccgtctcgggactcccggcggcagc
gtgctggcccgccagatcgtcaactgcgccggattgcagtgcgaccgggtggcggtcctc
gccggtcttcgccccggcgtgcgcattgtcccctttcgcggcgaatactacctgctgcgg
ccggcggcgagatcgctggtacgcaacctcatctatccggttcccgacccggcgtttccc
tttctcggtgtccatttcacccgcatgatcgacggccgggtggaagccgggcccaacgcg
gtgctcgcctttcgccgcgaggggtacgaccgcctcagctggtcgctgcgcgacagcctg
gcgaccttcacctatccgggtttctggcacctggcggcgcgttactgggacaaggggctg
ggagagttccagcgttccttcagcaaggggctctttgtgcgggacctgcagcggctgatt
ccggcgctgcgcgaagaggatgtggaacggggcggcgcaggtgtccgcgcccaggcgatt
gccgccgatggttccctgctcgacgactttcatatcctggagggggaggggatggttcac
ctgctcaatgcgccgtccccggccgcgaccgcgtccctgagtatcggggcgaccgttgcc
gacaccacccttaaacagctgcagggctga

DBGET integrated database retrieval system