KEGG   Dehalococcoides mccartyi VS: DhcVS_1254Help
Entry
DhcVS_1254        CDS       T01136                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
dev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dev01100  Metabolic pathways
dev01110  Biosynthesis of secondary metabolites
dev01130  Biosynthesis of antibiotics
dev01230  Biosynthesis of amino acids
Module
dev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DhcVS_1254 (trpC)
Enzymes [BR:dev01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DhcVS_1254 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C NanE ThiG FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACZ62356
UniProt: D2BJ56
Position
1153802..1154581
Genome map
AA seq 259 aa AA seqDB search
MILERIVSDNLPDLKRRKEELPLLKLQALVADIPCPPLDMAASLKGNGIKLIAEVKKASP
SKGIIRPDFEPVDIARIYARNGAAAISVLTEEHHFQGSLDNLKLIRESGEALNLPLLRKD
FIHDPYQVYEARLYGADAILLIVAMLTPQKLEELLSLSHTLGMKCLVEVHTRPELDIALK
SNARIIGLNNRNLHTFQVDLSVTETLRPLIPPEHIVVSESGIQTRADISRLAELGVDAVL
IGEALTASADIAAKMRELL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgatattggaacgtatagtatccgacaatctgcctgatttgaagcgacggaaagaggaa
ctgcctcttttgaaactgcaggcattggtagcggacataccctgtccaccccttgacatg
gcggcaagcctgaaaggcaacggcattaagcttattgccgaggtcaaaaaggcctcaccc
tcaaaagggataatccggcctgactttgagccggtggatattgcccgcatatacgcccga
aatggggcggccgccatttcggtactgaccgaagaacaccattttcagggcagccttgat
aatttaaaactaatacgtgaatccggggaggcattaaatctgcctttgctgcggaaagat
tttatccatgacccgtatcaggtatatgaagcccgcctgtacggggcagacgctattttg
ctgatagtggccatgcttacaccccagaaactggaggaactgctttcactcagccacacg
ctgggtatgaaatgcctggtagaggtgcatacccggcctgaactggacatagccctcaag
agcaatgcccggattatcggcctgaataaccgtaatttgcatacatttcaagtggactta
agcgtaaccgaaaccctccgccccctgataccgcctgaacacatagttgtcagcgaaagc
ggcattcaaaccagagcggacatatcccgtctggcagagctgggggtagatgcggtgctt
ataggggaagccctgacggcctcggctgatattgccgccaagatgagggaactgctgtga

DBGET integrated database retrieval system