KEGG   Dehalococcoides mccartyi VS: DhcVS_551Help
Entry
DhcVS_551         CDS       T01136                                 

Definition
(GenBank) radical SAM superfamily
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
dev  Dehalococcoides mccartyi VS
Brite
Enzymes [BR:dev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DhcVS_551
Transfer RNA biogenesis [BR:dev03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DhcVS_551
Chromosome and associated proteins [BR:dev03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    DhcVS_551
   HAT complexes
    Elongator complex
     DhcVS_551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-ProteinID: ACZ61703
UniProt: D2BHA3
Position
521163..522542
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFDATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIVMGGTFLSADTAYQYGFIKDCYDALNGIVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGETEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHTVADV
AEATRLLREYGLKVHYHWMPGLPGSAPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTV
LEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASEGNEIFLSFEDSSDTLYGL
LRLRIPRLSLPVPDKKYGGKIGLVRELHVYGIELSLGEQRDQSAQHRGLGRKLVAEAERL
AHDEYGLSSLAILSGVGAREYYRSLGYELSAGYMCKRLA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggcgttaccccggtggcggttatgaccaaacct
ctgccgtgtcccggcaagtgcatatattgtcctacttttgatgccactccccagagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaatatcaggcttacaaacag
gttgcccttcgcctgcggataatacaggatatgggtcaccctacagataaggttgagctt
atagttatgggtggtactttcctttcagcagataccgcctaccagtatggtttcattaaa
gactgctatgatgcgttgaatgggatagtggctggcagtctggaggaagctaagactata
aatgaaactgctcagcaccgctgcgtaggtttatgcattgagacccgcccggatatctgc
ggtgagaccgaaatacagcggatgatagatttcggaactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataaactggttgaacggggacatacagttgcggatgtg
gctgaggccacccgccttttgcgtgaatacggcctaaaagtgcattaccactggatgccc
ggacttcccggttcagcccctgaaaaagatctggcactttcccgcatggtgtttgaagat
ccccggttttgccctgacgggcttaagctttatcccactatggtagtggaggggactgta
cttgaggagtggtggaaagaaggcagatatacaccgtacccaagtgacatcatgaccggg
cttattgcggatattaaagctctggtgccgccttatgtgcgtatctcacgagttcttcgg
gacataccggcggtatttatcagcgcgggactcaaagactccctgagggatggtgttcgg
cagatactggaaagccgccaccaaaagtgcaggtgtatacgctgtcgtgaatatggccac
cgccagcggaaaggacaaaccagtggtgaacccaccttaaggcgacttgattatcctgct
tcagagggcaacgagatatttcttagctttgaggattcttccgataccctttatggtttg
ctcaggttgcgtatacctcgtttatccctgcctgttccggataaaaaatacggcggtaaa
atagggctggtacgtgaactgcatgtatatggcatagaactctcactgggtgaacagaga
gaccagtctgcccagcaccggggtcttggcagaaagctggtggccgaggcagaacggctt
gcccatgacgaatacggccttagctcactggcaatactaagcggtgtgggcgccagagag
tattaccgttcactcgggtatgaactttcggcagggtatatgtgtaagcgtctggcttga

DBGET integrated database retrieval system