KEGG   Dehalococcoides mccartyi VS: DhcVS_649Help
Entry
DhcVS_649         CDS       T01136                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dev  Dehalococcoides mccartyi VS
Pathway
dev00010  Glycolysis / Gluconeogenesis
dev00051  Fructose and mannose metabolism
dev00562  Inositol phosphate metabolism
dev01100  Metabolic pathways
dev01110  Biosynthesis of secondary metabolites
dev01120  Microbial metabolism in diverse environments
dev01130  Biosynthesis of antibiotics
dev01200  Carbon metabolism
dev01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DhcVS_649 (tpiA)
   00051 Fructose and mannose metabolism
    DhcVS_649 (tpiA)
   00562 Inositol phosphate metabolism
    DhcVS_649 (tpiA)
Enzymes [BR:dev01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DhcVS_649 (tpiA)
Exosome [BR:dev04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DhcVS_649 (tpiA)
  Exosomal proteins of bladder cancer cells
   DhcVS_649 (tpiA)
  Exosomal proteins of melanoma cells
   DhcVS_649 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACZ61789
UniProt: D2BHI9
Position
complement(607069..607824)
Genome map
AA seq 251 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACILVQSMKGELETIDGIEKIVCPPFISLSHIKTILENSSIK
LGAQNLFYEEKGAYTGEISPLMLKELCQYVIIGHSERREYFGETGQVVNQKIKAAIQAGI
LPIVCVGEKLEENEKGQTRQVLETQLKEALNGLSLSSIIIAYEPIWAIGTGKAATASAAN
AAICYIRKVLSEILGNTAARKSSILYGGSVNEKNTAELLSQSDIDGALVGGASLKADSFI
SICRQAAAISK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagattattattgccggtaactggaaaatgaataccactctttccgaagcttgt
atactcgtacaaagcatgaaaggtgaacttgaaacgatagacggcattgaaaaaatagtc
tgcccgccttttatatccctgagtcacataaaaaccatactagaaaatagcagcatcaag
ctgggtgcccaaaaccttttttacgaagaaaaaggggcatatacaggtgaaatatccccc
ttgatgctgaaagagctctgccaatacgtgattataggccactctgaaagacgggaatat
ttcggtgaaacaggacaggttgtcaaccaaaaaataaaagccgctattcaggctggcata
cttccgatagtatgtgtgggtgaaaaacttgaagaaaatgagaagggccaaacccgccaa
gtattggaaactcagctaaaagaggctttgaatgggcttagcctgagcagtatcataata
gcttatgaacccatttgggctataggcaccggcaaggctgccaccgcttcagcagccaat
gcggcaatctgttatatacgtaaggtattaagtgaaattctggggaacactgcagcccga
aaatcttccatactctatggaggcagtgtaaatgaaaaaaataccgccgaactcctctct
cagtcagatattgacggggcactggtaggcggagcttcactgaaggctgattcttttata
agcatttgccgccaagccgccgctatttcaaaataa

DBGET integrated database retrieval system