KEGG   Dehalogenimonas sp. WBC-2: DGWBC_0102Help
Entry
DGWBC_0102        CDS       T03938                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dew  Dehalogenimonas sp. WBC-2
Pathway
dew00260  Glycine, serine and threonine metabolism
dew01100  Metabolic pathways
dew01110  Biosynthesis of secondary metabolites
dew01120  Microbial metabolism in diverse environments
dew01130  Biosynthesis of antibiotics
dew01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dew00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DGWBC_0102
Enzymes [BR:dew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DGWBC_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKG52792
UniProt: A0A0F7GBU8
Position
85952..86995
Genome map
AA seq 347 aa AA seqDB search
MERMRIIDLRSDTITHPTHAMREAMYRAEVGDDVFGEDVTVNRLEELSAEITGKEAAVYT
PSGTMSNLLAILSHTRRGDEVILGDRAHIFLNEVGGAAALGGVSLRTLPNNPDGTIDIDL
IEGAIRGQNLHWPPSTLLCLENSHNFCGGSVLDVEYTIEAAEVAHRHGMKVHLDGARIFN
AAVSLNTPVIELCEPVDSVCFCLSKGLSAPVGSVLCGSTEFINRARKLRKMVGGGMRQAG
VIAAAGVVALETMVERLSEDHHNAKILAEKLSQFPGIKVERPETNIVMFGTPDGIPAADF
IKTAGMVGVKMIAVGPHRVRAVLHRMVTAEDVGEAIEKLKTVMGSGI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcatgaggataattgatttaagaagcgacactattactcatcccacccacgcg
atgcgggaagctatgtaccgcgctgaagtgggtgatgatgtttttggtgaggacgtcacg
gttaaccgcctggaggaattatctgctgaaattaccggcaaagaagcggcggtttatacc
cccagtggtacaatgagcaacttgttggcaatcctaagtcatacccgccgcggtgatgaa
gttatcctgggtgaccgggctcatattttcttaaatgaggtcggcggtgcggctgcactg
ggtggcgtatctctcaggacgttgcctaataatcccgatggcaccattgatattgacctg
attgagggcgcgatccgcggtcaaaacctgcactggccgccttcaacgctgctttgtctt
gaaaacagccacaacttttgcggcggcagtgtgcttgacgtggaatatactattgaagct
gctgaagtggctcatcgacatggtatgaaagtccaccttgatggtgccaggatttttaac
gccgcagtcagcttgaatactccggttattgaactgtgtgaaccagtagattcggtttgt
ttctgtctttccaagggtttgtccgctccagtgggctcagtgttatgcggcagcactgag
tttattaaccgggccaggaagctgcggaaaatggtcggtggtggtatgcgccaggccgga
gtaatcgccgcggcgggcgttgttgccctggaaacgatggttgagcgtctgtcggaagac
catcacaacgccaaaatattggccgaaaaactatcgcaatttcccgggatcaaagtcgag
agacctgagaccaacattgtcatgttcggcacccctgacggcattccagctgctgacttt
atcaagacggccgggatggtgggagtgaagatgattgccgtcgggccgcaccgggttcga
gcggtgcttcaccgcatggtgacagcggaggatgttggagaggcgatagaaaaattgaaa
acagtcatgggctcaggtatatga

DBGET integrated database retrieval system