KEGG   Dehalogenimonas sp. WBC-2: DGWBC_1388Help
Entry
DGWBC_1388        CDS       T03938                                 

Definition
(GenBank) 5-methyltetrahydrofolate:corrinoid iron-sulfur protein methyltransferase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
dew  Dehalogenimonas sp. WBC-2
Pathway
dew01100  Metabolic pathways
dew01120  Microbial metabolism in diverse environments
dew01200  Carbon metabolism
Brite
Enzymes [BR:dew01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     DGWBC_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AKG54028
UniProt: A0A0F7GFG2
Position
1339109..1339990
Genome map
AA seq 293 aa AA seqDB search
MVLLIGENINVMSRSIGAAFKERQSEPVRSVAKELTEACMDYLDLNIGPAKKHGAELMPW
LVSTVQEVSDLPLSLDTTNIAAIEAGLKLCKQRALVNSVSLQPERIEQLLPLVKEHKAEM
IGLLWGSDGMPRDANERCMLTVDLVYKANQMGIANQDIWIDPIATPVSGEISQVTACVEF
MAMLPDIAPGCKSIVGLSNVSNGTPQHLRPMLNRTYLIMLMRYGLYAAIVDAFDKELQEI
ARGRAQDIVNIVHRAMDDENINLNSLNKVERNYVKTVRVLTGQALYSDSWLEI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtattactgatcggcgaaaacattaacgtgatgtcccggagtatcggagcggcgttc
aaggagcgccaatctgagccggtacgatccgttgccaaggagttaactgaggcctgcatg
gattacctggatctgaatatcggcccagccaaaaaacatggcgccgaactgatgccgtgg
ctggtatctaccgttcaggaggtaagcgacttgcctctgtctttggatacaacaaatata
gcagcaatagaggctgggttgaagctgtgcaagcagcgggccttagttaattcagtctca
ttacagccagaacgcattgaacaattactgccattggtaaaagaacataaggctgagatg
atcggattgttatggggtagtgacggcatgccgcgagatgccaatgaacgctgtatgctc
accgtggacctggtatacaaggccaatcagatgggaatagccaaccaggatatttggata
gaccccatcgctactccggtcagcggtgaaataagtcaggtaaccgcctgcgttgaattc
atggcaatgctgccggacatagctcctggttgcaagtctattgtcggactgtctaacgtc
tccaacggtaccccacaacatctgcgcccaatgctgaatcgtacctatctgattatgtta
atgcgctacggattgtatgcagccattgtagatgcttttgacaaggagcttcaggagatt
gcgcgcggcagagctcaggacatcgttaatatagttcaccgtgctatggatgatgaaaac
atcaatttaaactctttaaacaaggtggaacggaattatgtcaagacggtacgagtatta
acagggcaggcattatattctgattcatggctcgaaatctga

DBGET integrated database retrieval system