KEGG   Dechloromonas sp. HYN0024: HYN24_01620Help
Entry
HYN24_01620       CDS       T05616                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dey00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HYN24_01620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dey03011]
    HYN24_01620
Ribosome [BR:dey03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HYN24_01620
  Bacteria
    HYN24_01620
  Archaea
    HYN24_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXS78842
UniProt: A0A3B7A3S2
Position
334187..334516
Genome map
AA seq 109 aa AA seqDB search
METRANLRGVRLSAQKGRLVADLVRGKPVGQALNILAFCPKKGAGIVKKVLESAIANAEH
NDGADIDELTVKTIYVEKGMVLKRFTARAKGRGNRIIKPTCHIYLTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcgtgcaaatttgcgaggcgtacgcctctctgcgcaaaagggccgcttggtt
gcggacctcgtgcgcggcaagccggttggccaggctctgaacatcctggctttctgcccc
aaaaagggcgccggtatcgtcaagaaagtgctggagtcggcaattgccaacgccgagcac
aacgatggtgctgatatcgacgaactgacggtgaaaaccatctacgttgaaaaaggcatg
gtgctcaagcgtttcaccgcgcgcgccaagggtcgtggcaatcggatcatcaagccgacc
tgccatatctatctgaccgttggtaactaa

DBGET integrated database retrieval system