KEGG   Dechloromonas sp. HYN0024: HYN24_06900Help
Entry
HYN24_06900       CDS       T05616                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dey00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYN24_06900 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dey02022]
    HYN24_06900 (ompR)
Two-component system [BR:dey02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   HYN24_06900 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AXS79769
UniProt: A0A3B7A579
Position
complement(1460491..1461216)
Genome map
AA seq 241 aa AA seqDB search
MNEQHQHILVVDDDARLRDLLTRYLGEQGFAVKAAADGQQMDKLRAREHYHLIVLDLMMP
GEDGLTICRRLRGQGDRTPIIMLTAKGDEIDRIVGLEMGADDYLPKPFNPRELLARIHAV
LRRQGSKPPGAPADDQEKITFGNIEVDLAARTLTRGNELQSLTTGEFAVLKVLLHHPRQP
LSRDKLMTLARGREQGPFDRAIDVQVSRLRKLIEIDPAQPRYLQTVWGFGYVFVPDGAAK
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaacaccaacacatcctcgtcgtcgatgacgacgcccgcctgcgtgacctg
ctgacgcgttacctcggtgaacagggctttgccgtaaaagcggctgccgatggccagcag
atggacaagctgcgcgcccgcgaacattaccacctgatcgttctcgatctcatgatgccg
ggcgaggacggcctgaccatctgccgccgcctgcgcggccagggtgaccggacgccgatc
atcatgctgaccgccaagggcgatgaaatcgaccgcatcgtcggcctcgagatgggtgcc
gacgactatctgcccaagcccttcaatccgcgcgaactgctcgcccgcatccatgccgta
ctccgccgccagggcagcaagccacccggcgcaccggcggacgaccaggaaaagatcacc
ttcggcaacatcgaagtcgacctcgccgccagaacgctgacccgtggcaacgaattgcag
tcgctgaccaccggcgaatttgccgtactcaaggtactgctccatcaccctcgccagccc
ctgtcgcgcgacaagctgatgaccctggcccgcggacgtgaacaggggccattcgaccgc
gccattgacgttcaggtatcgcgcctgcgcaagctgatcgagatcgacccggcgcagccc
cgctacctgcagaccgtctggggcttcggttacgtcttcgtgccggatggcgccgccaag
gaatag

DBGET integrated database retrieval system