KEGG   Dechloromonas sp. HYN0024: HYN24_10760Help
Entry
HYN24_10760       CDS       T05616                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dey  Dechloromonas sp. HYN0024
Brite
KEGG Orthology (KO) [BR:dey00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HYN24_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXS80456
UniProt: A0A3B7A8R7
Position
complement(2243594..2244601)
Genome map
AA seq 335 aa AA seqDB search
MDTLNISLGVVVTLVIVALLFDFMNGFHDAANSIATIVSTRVLKPHHAVLWAASFNFIAY
FLFQLKVASTIGKGTIDPSIVDHYVVFGALVGAIIWNIITWYYGIPSSSSHALVGGLVGA
AVAKAGLASLISSGVLKIVAFIFVAPFLGFMIGGTLMVIVSWICRNMAPRKVDKHFRRFQ
LISAAAYSLGHGGNDAQKTVGIIWMLLIAAGISTTSDPIPGWVVLSCYTAMGLGTMFGGW
RIVKTMGNRITKLNQARGFCANTGGAITLFLATAFGIPVSTTHTITGAIAGVGSTRGARA
VRWGVAGGIVWAWILTIPCSAAMAALAWYLGSLIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacccttaacatcagtctcggggtcgtcgtcaccctggtgattgtcgccctgctg
ttcgatttcatgaacggctttcacgatgcagccaattcgatcgccaccatcgtgtcgacg
cgggtgctcaaaccgcaccacgcggttctgtgggccgccagtttcaatttcattgcctat
ttcctgtttcagctcaaggtagcctcaaccatcggcaagggcaccatcgacccgtcgatt
gttgatcactatgtggtttttggggcgctggtaggggcgattatctggaacatcattacc
tggtactacggcatcccgtcgtcgtcttcgcacgcgctggttggtggcctggttggtgct
gctgttgccaaggccgggctggccagcctgatttcctctggcgtcctgaagattgtcgcc
tttatttttgtcgcgcccttcctcgggttcatgatcggtggaaccctgatggtgattgtt
tcgtggatttgccgaaacatggcgccacgcaaggtggacaagcattttcgccgtttccag
ttgatctcggcggcggcttatagtctggggcatggtggaaatgacgcgcagaaaaccgtc
ggcatcatctggatgctgctgattgctgccggtatctcgacgacctcggatcccattccg
ggctgggttgtcctgtcctgttataccgctatgggtctcggcacgatgtttggtggctgg
cgtattgttaaaaccatgggcaatcgcattaccaaactcaatcaggctcgcggtttctgt
gccaatactggtggggccatcacgctgttcctggctacggcatttggtatcccagtttcc
actacccacactattactggcgctatcgctggtgttggttctacccgtggcgcacgtgcc
gtgcgctggggggtagccggcgggattgtctgggcatggattctgaccatcccctgtagt
gctgccatggccgccctggcctggtatctcggctcgctgattctctga

DBGET integrated database retrieval system