KEGG   Dechloromonas sp. HYN0024: HYN24_12505Help
Entry
HYN24_12505       CDS       T05616                                 

Definition
(GenBank) phenylphosphate carboxylase subunit delta
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00540  Lipopolysaccharide biosynthesis
dey01100  Metabolic pathways
Module
dey_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:dey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HYN24_12505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dey01005]
    HYN24_12505
Enzymes [BR:dey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     HYN24_12505
Lipopolysaccharide biosynthesis proteins [BR:dey01005]
 Unusual sugar
  HYN24_12505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase Clp_N HAD_2 HAD
Motif
Other DBs
NCBI-ProteinID: AXS80769
UniProt: A0A3B7A803
Position
2609721..2610248
Genome map
AA seq 175 aa AA seqDB search
MDNQTRAARIKLVAFDIDGVMTDGGLHYTDDGHELKTFNVQDGLGVVLLRRAGIDVAIIT
GRTSHVVSCRARDLGVEHVFHGVGDKGSVSAGLLEKLGLQWDELAFMGDDLIDLPAMTRC
GFAIAPANARPIVKQHAHMVTEAGGGKGAVREAIEFILTAQGKLDAAFAPYLGAS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaaacccgcgctgcccgcatcaagctcgtcgccttcgacatcgacggcgtg
atgaccgatggcggcctgcattacaccgacgacggacacgaactgaaaaccttcaacgtc
caggacggcctcggcgtcgtcctgctccggcgcgccggcatcgacgtcgccatcatcacc
ggccgcacctcccatgtcgtctcctgccgcgcccgcgacctcggcgtcgagcatgtgttc
cacggcgtcggcgacaaggggtcggtctccgccggcctgctcgaaaaactcggcctgcag
tgggatgaactggctttcatgggcgatgacctgatcgacctgccggccatgacccgctgt
ggtttcgccatcgcccccgccaatgcccgccccatcgtcaagcaacatgctcacatggtt
accgaggcgggcggcggcaagggtgccgtgcgtgaagccatcgaattcatcctgaccgcc
cagggcaagctcgatgcggctttcgccccctacctcggcgcatcatga

DBGET integrated database retrieval system