KEGG   Dechloromonas sp. HYN0024: HYN24_14200Help
Entry
HYN24_14200       CDS       T05616                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00362  Benzoate degradation
dey00621  Dioxin degradation
dey00622  Xylene degradation
dey01100  Metabolic pathways
dey01120  Microbial metabolism in diverse environments
dey01220  Degradation of aromatic compounds
Module
dey_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:dey00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYN24_14200 (dmpG)
   00622 Xylene degradation
    HYN24_14200 (dmpG)
   00621 Dioxin degradation
    HYN24_14200 (dmpG)
Enzymes [BR:dey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     HYN24_14200 (dmpG)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     HYN24_14200 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AXS81075
UniProt: A0A3B7AFU3
Position
complement(2957209..2958240)
Genome map
AA seq 343 aa AA seqDB search
MTLRGKKITVHDMTLRDGMHPKRHLMTLDQMVSIATGLDEAGIPLIEVTHGDGLGGSSVN
YGFPAHTDEEYLGTVIPKMKKAKVSALLLPGIGTVDHLKMARDLGVNTIRVATHCTEADV
SEQHITMARKLEMDTVGFLMMAHMNSAEGLVTQAKLMEGYGANCIYVTDSAGHLLPEGVK
ERLGAVRAALKPETELGFHGHHNLAMGVANSIAAIEVGANRIDAAAAGLGAGAGNTPMEV
LIAVCSLMGIETGVDVAKITDVAEDLVVPMMDFPIRIDRDALTLGYAGVYGSFLLFAKRA
SVKYGVPARDILVELGRRGMVGGQEDMIEDTAMSMARERGLLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacgcggcaagaaaattaccgtccatgacatgaccctgcgcgatggcatgcat
cccaagcgtcacctcatgacgctggaccagatggtcagcatcgccaccggcctcgacgaa
gccggcattccgctcatcgaagtcacccacggtgacggcctcggtggttcctcggtcaac
tacggcttcccggcccataccgatgaggaatacctcggcaccgtcatccccaagatgaag
aaggccaaggtctcggccctgctcctgcccggcatcggcacggtcgatcacctcaagatg
gcgcgtgacctgggtgtgaacaccatccgcgtcgccacccactgtaccgaggcagacgtc
tccgagcagcacatcaccatggcgcgcaagctcgagatggacaccgtcggcttcctgatg
atggcccacatgaacagtgccgaaggtctggtcacccaggccaagctgatggaaggctac
ggcgccaactgtatctacgttaccgattcggccggccatctgctgccggaaggcgtcaag
gaacgcctcggcgccgtgcgtgcggcgctcaagccggaaaccgaactcggcttccacggc
caccacaacctggccatgggtgtcgccaactccatcgccgccattgaagtcggggccaac
cgcattgacgccgccgccgctggtctgggtgccggtgctggcaatacgccgatggaagtg
ctgatcgccgtgtgcagcctgatgggtatcgaaacgggcgttgatgtcgccaagatcacc
gacgtcgccgaagacctcgtcgtgccgatgatggacttcccgatccgtatcgaccgtgat
gccctgaccctcggctatgccggcgtctatggctccttcctgttgttcgccaagcgggcc
tccgtcaagtacggcgtgccggcccgcgacatcctggtcgaactgggccgtcgcggcatg
gttggcgggcaggaagacatgattgaagacactgccatgagcatggcgcgtgaaagagga
ctgctgaaatga

DBGET integrated database retrieval system