KEGG   Deinococcus irradiatisoli: DKM44_02690Help
Entry
DKM44_02690       CDS       T05530                                 

Definition
(GenBank) transcriptional regulator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
dez02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_02690
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DKM44_02690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dez03000]
    DKM44_02690
Transcription factors [BR:dez03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    DKM44_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp MarR_2 HTH_24 HTH_5 GntR TrmB MarR DUF1013 DUF1670 HTH_23 HTH_36
Motif
Other DBs
NCBI-ProteinID: AWN22277
UniProt: A0A2Z3JAY2
Position
complement(520674..521369)
Genome map
AA seq 231 aa AA seqDB search
MNYPSLVWHLKRTELFADLELAELERVAATTPYRSYQPGEVIYRMDDPADALYFVRSGLV
KISKLFPNGKEAILSVVGQHDTFGELLLQPEERRPTQAEALERTTLIVLPRNELQKLLSA
KPDLAMKLIRLMAARLFEAQAWSAEVSAYSAPERVASLLYRLAREFGRPHPQGVELSLKL
NQEDIARMVGATRETVSHSLSKLKQEGAIVRPRTPIIVRMDALKRYIEAGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcccagtctggtatggcatctcaagcgcaccgagctgttcgcggatctggag
ctggccgagctggaacgggtcgccgccacgacgccttaccgctcgtaccagccgggtgaa
gtcatctaccgcatggacgacccagccgacgcgctgtatttcgtgcgctccgggctggtg
aaaatcagcaagctctttcccaacggcaaggaagcgatcctgagcgtggtgggccagcac
gacaccttcggcgaactgctgctgcaacccgaggagcgccgccccacgcaggccgaggcc
ctggagcgcaccaccctgatcgtgctgccgcgcaacgaactgcaaaaattgctctcggcc
aagccggacctcgccatgaaactcattcgcctgatggccgcccggctcttcgaggcccag
gcctggagcgccgaggtcagcgcctacagcgcgcccgagcgggtggcgagcctgctctac
cggctggcgcgcgagttcggccgcccgcatccgcagggggtggagctgagcctcaagctc
aaccaggaagacatcgcccggatggtcggggccacccgcgagacggtaagccacagcctg
agcaaactcaagcaggaaggcgccatcgtgcgcccccgcaccccgatcatcgtgcggatg
gacgccctgaagcgctacatcgaagccggcgagtaa

KEGG   Deinococcus irradiatisoli: DKM44_08675Help
Entry
DKM44_08675       CDS       T05530                                 

Definition
(GenBank) Crp/Fnr family transcriptional regulator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
dez02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_08675
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DKM44_08675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dez03000]
    DKM44_08675
Transcription factors [BR:dez03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    DKM44_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp HTH_24 FeoC MarR_2
Motif
Other DBs
NCBI-ProteinID: AWN23293
UniProt: A0A2Z3JDN7
Position
1741775..1742449
Genome map
AA seq 224 aa AA seqDB search
MLPGFLAALPEAARIPLLAATRQHRWSRGSIVLHADDPAETLYMLQSGHARLYRLGSSAR
EVTVNVHGPGDLLGLTALLTDGKYGLYAEAMDDLSALMIGGEALRELMGRFPDLSVALST
QVVRQTRGLQDRLSQLVFLEVSQRLALALLELANESGESHEHQVALRGRISHQDLAHAVG
STRETITKLLGEFRAKGLLDLGYRRIVVMDRSGLERAARQPLGA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctggctttcttgccgccctgcccgaagcggcccgtattccgctgctcgccgcc
acccgccagcaccgctggagccggggcagcatcgtgctgcacgccgatgacccggccgag
acgctgtacatgctgcaaagcggtcacgcccggctctaccgcctgggcagcagcgcccgc
gaggtgacggtcaacgtgcacggccccggcgacctgctgggcctcaccgcgctgctgacc
gacggcaagtacggcctgtacgccgaggcgatggacgacctctcggccttgatgatcggc
ggcgaggcgctgcgcgaactgatggggcgctttccggacctgagcgtggcgctcagcacc
caggtggtgcgccagacgcgcggcctgcaagaccggctctcgcaactggtgtttctggaa
gtctcgcagcggctggccctggccctgctcgaactcgccaatgagagcggcgagagccac
gagcatcaggtggcgctgcgcgggcgcatctcgcaccaggatctggcgcacgcggtgggc
agcacccgcgagaccatcaccaaactgctcggcgagttccgggccaaggggctgctcgat
ctgggctaccgccgcatcgtggtgatggaccgcagcggtctggaacgggccgcccgccag
cctctgggagcctga

DBGET integrated database retrieval system