KEGG   Deinococcus irradiatisoli: DKM44_03155Help
Entry
DKM44_03155       CDS       T05530                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_03155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dez02022]
    DKM44_03155
Two-component system [BR:dez02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DKM44_03155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ DUF2173 T2SSE
Motif
Other DBs
NCBI-ProteinID: AWN22356
UniProt: A0A2Z3JE81
Position
617525..618253
Genome map
AA seq 242 aa AA seqDB search
MTEILVAEARLGVRKALERLIEGLGMRPRSVSSAAQLRRELLRQRPDVVILGLGLPDEDG
AALCRELQPEQLNVLLLGQIDEGAARVAGAAGVLQLPLEPLELAAQLHHLLGTAPPELGD
TQLLQQLMERPGVLAITTYDAAGTLKRSAGDELPMGLGQRARTYLDASRWLGGAGEGLPA
LRGAGLATRELCVIQVEYGERCLLLFEEPGGITACLLRDSASASLMKYWLRSSRHSEGQL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcctggtggcggaggcccgcttgggggtgcgcaaagcgctggagcggttg
atcgagggcctgggcatgcgcccccgcagcgtcagcagcgccgcgcaactgcgccgcgaa
ctgctgcgccagcgcccggatgtggtgattctcggcctgggtctgccggacgaggacggc
gcggcgctgtgccgggagctgcagccggaacagctgaacgtgctcctgctcggccagatc
gacgaaggcgcggcgcgggtcgccggcgctgcgggcgtgctgcagttgccgctggagccg
ttggaactcgcggcgcagcttcaccacctgctcggcacggcgccgccggaactcggcgac
acgcagctgctgcaacaactcatggagcggcccggcgtgctggcgatcaccacctacgac
gccgccggcacactcaagcgcagcgccggggacgagctgccgatgggcctgggccagcgc
gcccgaacgtatctcgacgcttcccgctggctgggcggggcaggtgagggactgccggcc
ctgcgcggcgccggactggcgacccgagagctgtgcgtcattcaggtggaatacggcgag
cgctgtctgctgctcttcgaggaacccggcggcatcaccgcctgcctgctgcgtgacagt
gccagcgccagcctgatgaagtactggttgcgctcgtcacggcatagcgaaggtcaactg
caaccttaa

DBGET integrated database retrieval system