KEGG   Deinococcus irradiatisoli: DKM44_03670Help
Entry
DKM44_03670       CDS       T05530                                 

Definition
(GenBank) transcriptional regulator
  KO
K04751  nitrogen regulatory protein P-II 1
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P-II
Motif
Other DBs
NCBI-ProteinID: AWN22444
UniProt: A0A2Z3JMJ3
Position
722769..723164
Genome map
AA seq 131 aa AA seqDB search
MAATRSGMKLITAVVRPERVQHVKEALFQAGISGLTLGRVSGHGGEQEVVEHYRGTRVMV
EFREKVEFKMAVSEPFVEAAIAAICKGARTGEVGDGKIFVQPLERVVRIRTGEEDNSALT
PVTEKKLAPLT
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacaaggagcggcatgaaactgattaccgcagtcgtccggcccgaacgggta
caacacgtcaaggaagcgctgttccaggccgggatcagcggtctgacgctcggccgtgtc
agcgggcacggcggcgaacaggaagtcgtcgagcactaccggggcacccgcgtgatggtg
gagttccgcgagaaggtggagttcaagatggccgtcagcgagccgttcgtcgaggccgcc
atcgccgccatctgcaagggcgcgcgcaccggcgaggtcggcgacggcaagattttcgtg
cagccgctggaacgggtcgttcgcatccggaccggcgaggaagacaacagcgccctgacg
cccgtgaccgagaagaaactcgcgccgctgacctga

DBGET integrated database retrieval system