KEGG   Deinococcus irradiatisoli: DKM44_06450Help
Entry
DKM44_06450       CDS       T05530                                 

Definition
(GenBank) ABC transporter permease
  KO
K09696  sodium transport system permease protein
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02010  ABC transporters
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DKM44_06450
  09132 Signal transduction
   02020 Two-component system
    DKM44_06450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dez02000]
    DKM44_06450
Transporters [BR:dez02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Sodium transporter
    DKM44_06450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_3 ABC2_membrane ABC2_membrane_4 ChlamPMP_M DUF3377
Motif
Other DBs
NCBI-ProteinID: AWN22912
UniProt: A0A2Z3JCZ8
Position
complement(1289783..1291009)
Genome map
AA seq 408 aa AA seqDB search
MANVWTVTQQELRSTLRDRRTLMSTVLVPLLMIPLFTVGLPLLLGTLFGGQAQTRQTVGV
VGELPPALKSQLEQDSKSGKGVRLLPVGDPTAAVQQGDVDAALKVQTRLPSEAGNSGTLQ
LFYKVGNLKAESGAADKVKSAVSAYNDALVGRKLAQLGLTPTLLTPVKLSVVNASNAAEA
SSGALAFIIPLFLLQFILAGATAAATDSTAGERERGTFEALLATPTPRHTLLLGKLLATT
LTALTAAAFSVLGLSLSAPIALLVTPAGQSAAQSATQQAFGGSLVLGAGGLLAVLLTATT
AALVISALLLTLSLFARSVREAQTYIAPLTLLIVLPATLLQFADFLRASDALYAAPLVGS
MLVVLDTVKGALSWPHLLLSLGGNVLMAALLTLLATRLFGREGVAFKK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtggctaacgtctggacggtgacccagcaggaactgcgctccaccctgcgcgaccggcgc
accctgatgagcacggtgctggtgccgctgctgatgattcccctcttcacggtgggcctg
ccgctgctgctgggcaccctcttcggcgggcaggcccagacccggcagacggtaggtgtg
gtgggcgagttgccgccggccctgaaaagccagctggagcaggacagcaaaagcggcaag
ggcgtgcgcctgctgccggtgggcgaccccaccgccgccgtgcagcagggtgacgtggac
gccgccctcaaggtgcagacccgtctgcccagcgaagccggaaacagcggcaccttgcag
ctcttttacaaggtcggcaacctcaaggccgagagcggcgcggccgacaaggtcaagtcg
gcggtttcggcgtacaacgacgccctggtgggccgcaaactggcgcagctgggcctgacc
cccaccctgctgacgccggtcaagctcagcgtcgtgaacgccagcaacgcggccgaagcc
agcagcggggcgctggccttcatcattccgctgtttttgctgcaattcatcttagccggg
gccaccgccgccgccaccgacagcaccgccggggagcgcgagcgcggcaccttcgaggcc
ctgctggcgacccccacgccgcgccacaccctgctgctcggcaagctgctggcgaccacc
ctgacggccctcaccgccgccgccttcagcgtgctgggcctgagcctcagcgccccgatc
gccttactggtcacccccgccgggcagagcgcggcccagagcgccacccagcaggccttc
ggcggctcgctggtgctgggcgcgggcggactgctggcggtgctgctcacggccaccacg
gcggcgctggtgatcagcgctttgctgctgaccctgtcgttgttcgcccgctcggtacgc
gaggcgcagacctacatcgcgccgctgaccctgctgatcgtgctgcccgccaccctgctg
caattcgccgacttcctgcgcgccagcgacgcgctgtacgccgcgccgctggtgggcagc
atgctggtggtgctcgacaccgtcaagggcgcgctgagctggccgcacctgctgctgagc
ctgggcggcaacgtgctgatggcggcgctgctgaccctgctcgccacccgcctgttcggg
cgcgagggggtggccttcaagaagtag

DBGET integrated database retrieval system