KEGG   Deinococcus irradiatisoli: DKM44_07185Help
Entry
DKM44_07185       CDS       T05530                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_07185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dez01001]
    DKM44_07185
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dez02022]
    DKM44_07185
Enzymes [BR:dez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DKM44_07185
Protein kinases [BR:dez01001]
 Histidine kinases
  OmpR family
   DKM44_07185
Two-component system [BR:dez02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   DKM44_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 Virul_fac_BrkB HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AWN24531
UniProt: A0A2Z3JLX9
Position
1440293..1441483
Genome map
AA seq 396 aa AA seqDB search
MAAERSARRRRPRTGLRRRLTRVFALLALFAVALTSLLTVAAAYRALGDIAPALGLDHWP
PDGFSPRTATRLTPETGLPWRELGRVVGGELRRSAVTAAFLSFLVAVVLAAIVTRQITRP
LSRLAEAALRLEAGERDVQLPVPRRHDEVRDLTLTFNALTTSLKRQEAWRRGLMADIAHD
LRTPLSVLRSEIEAMQDGVNPADEAGLSRLHGEVLLLARLVTDLRTLSLAESGAMEFHPQ
RLDVAELLRGVTAAYQAPSQAAGVTLTLDAPAPVMVRADADRLLQVLHNLIGNALRYAAP
GEVELSAHASGHSVLLRVRDHGPGFQPGDLSRAFERFYRADASRSRDPGGLRSSGLGLAI
ARALTEAQGGVIEARNHPQGGAEFTVRLPGAAGEPL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgaacggtctgcgcgtcgccgccgtccccgaacggggctgcggcggcgactg
acccgcgtgtttgccttgctggcgctgttcgccgtggcgctgacctcgctgctcaccgtg
gcggcggcttaccgggcgctgggcgacatcgccccggccttggggctggaccactggccg
ccggatgggttttctccccgcacggcgacccgcctgacgccggagaccgggttgccctgg
cgcgaactcggccgggtggtgggcggcgaactgaggcgcagcgccgtcacggcggcgttt
ttgagtttcctggtggcggtggtgctggcggccatcgtgacccggcagatcacccgcccg
ctttcacggctggccgaggcggccctgcggctggaggccggcgagcgcgacgtgcagctg
ccggtgccgcgccgccacgacgaggtgcgcgatttgaccttgacctttaacgccctgacc
accagcttgaagcgccaagaagcctggcggcgcgggctgatggccgacatcgcccacgac
ctcagaacgcccctgtcagtgctgagatcagagatcgaagcgatgcaggacggcgtcaac
ccggccgacgaagccggactctcccggctgcacggcgaggtgctgctgctggcccggctg
gtcaccgatctgaggacactcagcctggccgagagcggcgcgatggagtttcacccgcag
cgccttgacgtggccgaactgctgcgcggcgtgacggcggcctatcaagcgcccagccag
gccgcgggcgtgacgctcacgctcgacgctcccgcgccggtgatggtccgggccgatgcc
gaccgcctgctgcaggtgctgcacaacctgatcggcaacgccctgcgctacgccgcgccc
ggcgaagtggagctcagcgcccacgccagcggccacagcgttctcctgcgggtgcgtgac
cacggccccggattccagcccggcgatttgtcgcgggccttcgagcgcttttaccgcgcc
gacgccagccgcagccgcgatcccggcggcctgcgcagcagcggcctggggctagcgatc
gcccgtgccctcaccgaagcgcagggcggcgtgatcgaggcccgcaaccatccgcagggc
ggcgcggaattcacggtgcgcctgcccggcgcggcgggggagccgctgtag

KEGG   Deinococcus irradiatisoli: DKM44_13775Help
Entry
DKM44_13775       CDS       T05530                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_13775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dez01001]
    DKM44_13775
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dez02022]
    DKM44_13775
Enzymes [BR:dez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DKM44_13775
Protein kinases [BR:dez01001]
 Histidine kinases
  OmpR family
   DKM44_13775
Two-component system [BR:dez02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   DKM44_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_5 BMFP
Motif
Other DBs
NCBI-ProteinID: AWN24165
UniProt: A0A2Z3JGP6
Position
complement(2790932..2792308)
Genome map
AA seq 458 aa AA seqDB search
MKSPLHAPDRRAAEHLGVRTWPWQRLSVSIIAAMLLMTVIMAISMVAVSSYSVQRQFDNM
PPELRSQFEQGVQVDVGRKLAQGITTPRFSLVPSEPANPAPSPDGLAQTQPQTQQPTNHP
PNTQQPPRLSRAERIRRDLLTNLLWAITISGVTAVFIGALLARLISRPVDEVSRAAQQVA
GGNLAARARQWPGNLELINLTRNFNRMAGSLDTLERERRDMIADIAHELRTPLAVVQARL
DAFEDQVLEPTPQELALVSMQIGLLTRLVSDLRTLSLADAGRLPLQLAPLDLSALSLRIS
QSFASKAQAADIRLDLQLPDEELPVQGDRDRLGQVLVNLLENALRYTPAGGQVTVSAGRR
QGQAVLSVCDSGPGFPAGSEQQVFTRFFRADQSRTRDSGGTGLGLAIVAALVGAHGGAVQ
ARNAQGGGAEVEVCLPLHEESETPENENGWRELAARAS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcgccgctgcacgcgccggaccgccgggccgccgagcacctgggggtgcgcacc
tggccctggcagcgcctgtcggtgagcatcatcgcggcgatgctgctgatgacggtgatc
atggccatcagcatggtggcggtgtcgagctactcggtgcagcgccagttcgacaacatg
cccccggaactgcgcagccagttcgagcagggcgtgcaggtggacgtggggcgcaagctg
gcccagggcatcaccacgccgcgcttcagcttggtgccctcagagccggccaacccggcg
ccctcgccggacggcctggcccagacccagcctcagacccagcagcccaccaaccacccg
ccgaatacccagcagccgccgcgcctgagccgggccgagcgcatccggcgcgacctgctg
accaacctgctgtgggccatcaccatttccggcgtcacggcggtgttcatcggcgccctg
ctggcccggctgatctcgcgtccggtggacgaagtctcccgggccgcccagcaggtggcc
ggcggcaacctcgccgcccgcgcccggcagtggcccggcaacctggaactcatcaatttg
acgcgcaacttcaaccgcatggccggcagcctcgataccctggagcgcgaacgccgcgac
atgatcgccgacatcgcccacgaactgcgcacgccgctggcggtggttcaggcccgcctc
gacgccttcgaggatcaggtgctcgaacccacgccccaggaactggcgctggtctcgatg
cagatcgggctgctgacccggctggtgagcgatctgcgtaccctctcgctggccgacgcc
gggcgactgccgctgcaactggcgccgctggacctctcggccctgtcgctgcgcatcagc
cagtcgtttgccagcaaggcgcaggcggccgacattcggctcgacttgcagctgcccgac
gaggagctgccggtgcagggcgaccgcgaccggctggggcaggtgctggtgaacctgctg
gaaaacgcgctgcgttacaccccggcaggcgggcaggtgaccgtttcggcggggcggcgt
cagggccaggcggtgctgagcgtgtgcgattccggtcccggctttccggcgggcagcgaa
cagcaggtctttacccgttttttccgggccgaccagagccgcacccgcgattccggcggc
accgggctggggctggcgatcgtcgcggcgctcgtgggcgcccacggcggcgcggtgcag
gcccgcaacgcccagggcggcggcgccgaggtcgaggtctgcctgccgctgcacgaggaa
agcgagacgccagaaaacgaaaatggctggagggaactggcggcgcgggccagctga

DBGET integrated database retrieval system