KEGG   Deinococcus irradiatisoli: DKM44_10285Help
Entry
DKM44_10285       CDS       T05530                                 

Definition
(GenBank) CoA ester lyase
  KO
K01644  citrate lyase subunit beta / citryl-CoA lyase [EC:4.1.3.34]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_10285
Enzymes [BR:dez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     DKM44_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: AWN23566
UniProt: A0A2Z3JHT8
Position
2072169..2073035
Genome map
AA seq 288 aa AA seqDB search
MTAHPPHRFRSALFAPGNQPEVLKKLPRSHPDLAILDLEDAVPDTQSAKQQAREVAREAA
GWLAAHHPEQAVYVRLNAVHSPYFSEDLAALTSELAGVVLPKLERAAELDEALHQLAERG
LSHLQVMAGIETVAGVEHAAELLRGPVTSAYFGAEDYVADLGGVRSEAGLEVLYPRSRVA
MLCRLAGVAAFDIVVTKLRDEGAFYEDAQLGRSLGYGGKLCIHPAQVGLAHQVFSPSPEE
IKRAWALLAAYEEGQQEGRGVISFEGQMVDAPMLVRARAVLAAAEVEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacatcctccccaccgctttcgcagcgccctcttcgcgccgggcaaccagccc
gaggtgctgaaaaaattgccgcgttcccaccccgatctggcgattctcgatctggaagac
gcggtgcccgacacgcaaagcgccaagcagcaggcccgcgaggtcgcgcgtgaagccgcc
ggctggctcgcggcgcaccaccccgagcaggcggtgtacgtgcgcctcaacgccgtgcac
tccccgtatttctccgaggacctcgccgcactgacgtccgagctggccggggtggtgctg
cccaagctggaacgcgcggccgaactggacgaagcgctccaccaactcgccgagcgcggc
ctctcgcaccttcaggtcatggccggcatcgaaacggtggcgggagtggaacacgccgcc
gaactgctgcgcggcccggtgacctcggcgtatttcggcgccgaggattacgtggccgac
ctcggcggcgttcgcagcgaggccggactggaagtgctctacccgcgctcgcgggtggcg
atgctgtgtcggctggccggcgtggccgccttcgacatcgtggtcaccaaattgcgcgac
gaaggggccttctacgaggacgcccaactgggccgctccctggggtacggcggcaagctg
tgcattcacccggcgcaggtggggctggcccatcaggtgttcagcccctcgcccgaggag
atcaagcgcgcctgggcgctgctggccgcctacgaggagggccagcaggaagggcgcggc
gtgatcagcttcgagggccagatggtggacgccccgatgctggtgcgcgctcgggcggtg
ctggccgccgccgaggtggaagcgtga

DBGET integrated database retrieval system