KEGG   Deinococcus irradiatisoli: DKM44_11820Help
Entry
DKM44_11820       CDS       T05530                                 

Definition
(GenBank) chemotaxis protein CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
dez02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_11820
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DKM44_11820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dez02022]
    DKM44_11820
   02035 Bacterial motility proteins [BR:dez02035]
    DKM44_11820
Enzymes [BR:dez01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DKM44_11820
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     DKM44_11820
Two-component system [BR:dez02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DKM44_11820
Bacterial motility proteins [BR:dez02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DKM44_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AWN24653
UniProt: A0A2Z3JHR5
Position
2400689..2401690
Genome map
AA seq 333 aa AA seqDB search
MVGGSAGALEPLRELVAHLPADFPAALLVVIHCPPDLPSYLPQILQSAGSLPVSAVQQPA
ALESGHIYVAPPNRHLLVGRDEVRPSRGPRENRSRPSVDVLFRSAAYTHRASVIGVLLSG
MLGDGTSGLWTIKRLGGQAIVQHPEEALYPSMPLSALQEVAVDTILPVRDIAGDLLTRLG
APNFGQGAAEMDEHEWRRLQLEVSIADEGNAFAGGILTGGDPSPFTCPECHGTMVKIQEG
RTLRFRCHTGHAYSAPALLGELHRAAEANLWTTVRGMEEQVMLLDHLAKHAAEAGQLHTA
ELYRSEAAAVRRRIEPLRRLLWQDGALPVQPVE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggcggctcggccggcgcgctcgaaccgctgcgcgaactggtcgcgcacctgccc
gccgattttcccgccgccctgctggtggtgattcactgcccgccggacctgcccagttac
ctgccgcagattctgcagtccgccggctccctgccggtcagcgcggtgcagcagcccgcc
gcgctggaaagcgggcacatctacgtcgcgccgcccaaccggcacctgctggtgggaagg
gatgaagttcggcccagccggggaccacgcgagaaccgctcgcggcccagtgtggacgtg
ctgtttcgctcggcggcctacacccaccgcgcctcggtgatcggggtgctgctctcgggc
atgctcggcgacggcacctcgggactatggaccatcaagcgcctgggcggtcaggccatc
gtgcagcacccagaagaagcgctctatcccagcatgccgctgagcgccctgcaggaagtc
gccgtggacaccatcctgccggtgcgcgacatcgccggcgacctgctgacgcggctgggt
gcgccgaacttcggtcagggagcagcggagatggacgaacacgaatggcggcgcctgcaa
ctggaagtctcgattgccgacgagggcaacgcctttgccggcggcatcctgaccgggggc
gacccctcgccctttacctgtccggagtgtcacggcacgatggtcaagattcaggaaggc
cgcaccctgcgcttccgctgccacaccggccacgcctacagcgccccggcgctgctgggc
gagttgcatcgggcggccgaggccaatctgtggaccaccgtgcgcggcatggaagagcag
gtgatgctgctcgaccacctcgccaagcacgccgccgaggccggccagctgcacaccgcc
gagctctaccgctcggaagcggccgccgtgcgccgccgcatcgagccgctgcggcgactg
ctgtggcaagacggggcgctgcccgttcagccggtggagtaa

KEGG   Deinococcus irradiatisoli: DKM44_11825Help
Entry
DKM44_11825       CDS       T05530                                 

Definition
(GenBank) chemotaxis protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02020  Two-component system
dez02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKM44_11825
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DKM44_11825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dez02022]
    DKM44_11825
   02035 Bacterial motility proteins [BR:dez02035]
    DKM44_11825
Enzymes [BR:dez01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     DKM44_11825
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DKM44_11825
Two-component system [BR:dez02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DKM44_11825
Bacterial motility proteins [BR:dez02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DKM44_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 PAS_4 CheR_N PAS_8 PAS_9 MLTR_LBD CENP-F_leu_zip Methyltransf_12 Seryl_tRNA_N AIP3 GAS Filament RPW8 ZnuA PAS_7 DUF812 Golgin_A5 Spc7 CALCOCO1 FmiP_Thoc5 UPF0449 KxDL HOOK Fzo_mitofusin Tweety Phage_GP20 HMMR_N
Motif
Other DBs
NCBI-ProteinID: AWN23830
UniProt: A0A2Z3JKK1
Position
2401824..2404799
Genome map
AA seq 991 aa AA seqDB search
MSTADPSDSSGEPSGAQGPAPTPPDAPPVAVVGLGGSAGSLDAFERFFVGLPLGSELAFV
VVSHLDPHQESLMPEILQRCTVLPVLLIQDDMALKADHIYVTPPGFSVGVQGGRLRLEAL
ERAQGHIIDAFFSSLARDRGEQAVGVILSGMGQDGTAGLQAIKAAGGQVLVQDPQSAEFS
SMPEAAIKTGLADVVLPAEDIAPRLYELVTHTALLAPGDLEAEGQTELQKILLLVRSRTG
QDFTGYKVSTLVRRIDRRMKSQRIPALGRYLRFLIETPGEVEALAQDLTINVTRFFRDPD
AFARLKEHLRSTLMIREPDQVAVRVWVAGCSTGEEAYSVAIVLHELMEELGRPLSVQVFA
TDIDPQAIATARLGLYPHSIAQIVSAQRLGRYFKPSEEGYQIQGFIRESVVFAQHNTFSD
PPFTRLDLLCCRNLLIYLKTELQRHILAVFHYALKPGGLLFLGTSETLGPEREHFSTLDS
HWRIYRRGQEAARPLPSGQIVARGESSLLRRTALPFQPDLRPQQRTLSQQAQRVLLTQYA
PPAVVINLQGEILFVSGQTGRYLELPSGTPSPNNVLEMVQDNLRYDLAAAINTLKREPRE
LKVRSHLTGPSGSVLLEITLRPLHGPEQGLLLLIFHEQPASDAPRQDAPSEPYDMVQALR
QELHHTRETLQATVEEAFISVEELKSTNEEYQTTIEELKSTNEELMTSKEELQSLNEELI
TTNSEHQRIISELGQANDDMNNLLESAGIATLFLGNDFKIKRFTPRFANVIRLLPGDIGR
PIGDFHLKLRYPHFQRDVAQVLSTLLPFETQVQTDDGHWFLMRITPYRTASNFIDGVVVA
FTNLDSVKVLEEQASISARYAQALLERMPDAVMVFNGQKQLLAANPAFYRLLRTTPARSQ
GHSIDQLGLDQLALKEVQNALNQLLADGQPIRELLLDVDMPGLGRQPFKLEAWPAGAAED
GSGSGSGENVYLLLLENLSTIAARLGTDSGR
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
gtgtccactgccgatccatccgattcgtctggcgagccttccggcgcgcaaggccctgcg
cccaccccgccggacgcgccgccggtggcggtggtgggcctgggcggctcggcagggtcg
ctcgacgccttcgagcgctttttcgtcggcctgccgctgggcagcgaactggccttcgtg
gtggtgtctcacctcgacccgcaccaggaaagcctgatgccggagatcttgcagcgctgc
acggtgttgccggtgctgctgattcaggacgacatggcgctcaaggccgaccacatctac
gtgaccccgccgggcttcagcgtcggggtgcaaggcggccggctgcggctcgaagcgctc
gaacgggcccagggccacatcatcgacgcttttttcagcagcctggcccgcgaccggggc
gagcaggcggtgggcgtgattctctcaggcatgggccaggacggaacggcggggctgcag
gccatcaaggcggccggcgggcaggtgctggtgcaagacccgcagagcgccgagttctcc
tcgatgccggaggcggccatcaaaaccggcctggccgacgtggtgctgcccgccgaggac
atcgcgccccggctctacgaactcgtcacccacacggccctgctcgcgcccggcgatctg
gaggccgagggccagaccgagctgcaaaaaatcctgctgctggtgcgctcgcgcaccggg
caggactttaccggctacaaggtcagcacgctggtgcggcgcatcgaccggcgcatgaaa
agccagcgcattccggcgctgggccgctacctgcgcttcctgatagaaacgcccggcgag
gtcgaagcgctggcgcaggatttgaccatcaacgtcacccgcttttttcgcgaccccgac
gccttcgcccggctcaaggagcacctgcgcagcaccctgatgatccgcgaacccgatcag
gtggcggtgcgggtgtgggtggcgggctgctccaccggtgaagaagcctactcggtggcg
atcgtgctgcacgaactgatggaagagctggggcgcccgctgagcgtgcaggtgtttgcc
accgacatcgatccgcaggccatcgccaccgcccggctgggcctctacccgcacagcatc
gcccagatcgtctcggcccagcggctggggcgttacttcaagcccagcgaggagggctac
cagattcagggctttatccgcgagtcggtggtgttcgcgcagcacaacaccttcagtgat
ccgccgtttacccgcctggacctgctgtgctgccgcaatttgctcatctacctcaaaacc
gagttgcagcgccacatcctggcggtgtttcactacgccctcaagcccggcggcctgctg
tttctgggcaccagcgaaacgctggggccggagcgcgagcatttcagcaccctggattcg
cactggcgcatctaccggcgcggccaggaagcggcccggccgctgccctcgggccagatc
gtggcgcgcggcgaaagctcgctgttgcggcgcacggcgctgccgtttcagccggacctg
cgcccgcagcagcgcaccctctcgcagcaggcccagcgggtgctgctcacccagtacgcg
cccccggcggtggtgatcaaccttcagggcgaaatcttgttcgtcagcgggcagaccggg
cgctacctggagttgcccagtggcacgcccagccccaacaacgtgctggaaatggtgcaa
gacaacctgcgctacgatctggccgccgccatcaacacgctcaagcgcgaaccgcgcgaa
ctcaaggtgcgctcccatctgaccgggcccagcggttcggtgctgctggaaatcaccctg
cggccgctgcacggtccggaacagggcctgctgctgctgatcttccacgagcagcccgcc
agcgacgccccgcgccaggacgcgcccagcgagccctacgacatggtgcaggcgctgagg
caggaactgcaccacacccgcgaaacgcttcaggccaccgtcgaggaggcgtttatctcg
gtcgaagaactcaagagcaccaacgaggaataccagaccaccatcgaggaactcaagagc
accaacgaagaactgatgacctccaaagaggagttgcagtcgctcaacgaagaactcatc
accaccaacagcgagcaccagcgcatcatcagtgaactcgggcaggccaacgacgacatg
aacaacctgctcgaaagcgccggcatcgccacgctgtttctcggcaacgacttcaagatc
aagcgcttcacgccccggtttgccaacgtgattcgcctgctgcccggcgacatcgggcgg
ccgatcggcgactttcacctcaagctgcgctacccgcactttcagcgcgacgtggcccag
gtgctctcgacgcttttgcccttcgagacgcaggtgcagaccgacgacggccactggttt
ctgatgcgcatcaccccctaccgcaccgccagcaatttcatcgacggggtggtggtggcc
tttaccaacctcgacagcgtcaaggtgctcgaggagcaggccagcatctcggcgcgctac
gcccaggcgctgctggagcgcatgcccgacgcggtgatggtgtttaacggccagaagcag
ttgctggccgccaacccggccttctaccgcctgctgcgcaccaccccggcgcgcagtcag
ggccacagcatcgaccagctcgggctcgatcagctggcgctgaaggaagttcagaacgcg
ctcaaccagctgctcgccgacgggcagccgattcgcgaactgctgctcgacgtcgacatg
ccgggcctgggccgccagccgttcaagctcgaggcctggccggccggcgcagcggaagac
ggcagcggcagtggcagcggcgagaacgtatacctgctgctgctcgagaatctctccacc
atcgccgcacgcctgggcaccgacagcgggcgctga

DBGET integrated database retrieval system