KEGG   Deinococcus irradiatisoli: DKM44_11970Help
Entry
DKM44_11970       CDS       T05530                                 

Gene name
pstS
Definition
(GenBank) phosphate ABC transporter substrate-binding protein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
dez  Deinococcus irradiatisoli
Pathway
dez02010  ABC transporters
dez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dez00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DKM44_11970 (pstS)
  09132 Signal transduction
   02020 Two-component system
    DKM44_11970 (pstS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dez02000]
    DKM44_11970 (pstS)
Transporters [BR:dez02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    DKM44_11970 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 SBP_bac_1 PBP_like
Motif
Other DBs
NCBI-ProteinID: AWN23856
UniProt: A0A2Z3JIN3
Position
2436499..2437530
Genome map
AA seq 343 aa AA seqDB search
MKKILNLGLGLMLLTVSAASAATITGAGSSFVYPLYTKMFAEYKKDHNVDVNYQSVGSGA
GQQQIIARTVDFGASDNPMSDEAMKPAPGKLLQIPTAIGAVVPAYNLPGVSTKLNFTGKL
LADIYLGKVKLWNDAAIKKLNPDVTLPGLPITVARRSDGSGTTAVFTDYLSKVSSEWKSK
VGSANSVQWPVGVGGKGNDGVAGIVKSTPGAIGYVELTYAKQNNLLFGAVQNRAGKFIVA
DNGPAANAAQGVVIPADTRVSITNSANPAAYPISSFTYVIFYQDQKYANRSQADAKELKD
LLNWMVTTGQQYNEPLDYAKLPSSVVNKAKALINSINYGGAKL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattttgaacctgggcctcggcctgatgctgctcaccgtcagcgccgcttcc
gccgccaccatcaccggcgccggcagctcgtttgtctatccgctttacaccaagatgttc
gccgagtacaaaaaagaccacaacgtcgacgtgaactaccagtcggtcggctctggcgcc
ggccagcagcagatcatcgcccgcacggtggatttcggcgccagcgacaaccccatgtcc
gacgaggccatgaagcccgcccccggcaagctgctgcagattcccaccgccatcggcgcg
gtggtcccggcctacaacctgcccggcgtgagcaccaagctcaacttcaccggcaagctg
ctggccgacatctacctcggcaaagtcaagctgtggaacgacgcggccatcaagaagctc
aaccccgacgtgaccctgccgggcctgccgatcacggtggcccgccgctcggacggctcg
ggcaccaccgccgtgttcaccgactacctcagcaaggtcagcagcgagtggaagagcaag
gtcggcagcgccaacagcgtgcagtggccggtgggcgtgggcgggaagggcaacgacggc
gtggccggcatcgtcaagagcacgcccggcgccatcggctacgtcgagctgacctacgcc
aagcagaacaacctgctgttcggtgcggtgcaaaaccgggccggcaagttcatcgtggcc
gacaacggccccgccgccaacgccgcccagggcgtggtgattcccgccgacacccgcgtg
agcatcaccaacagcgccaaccccgccgcctacccgatctcgagctttacctacgtgatc
ttctaccaggaccagaagtacgccaaccgcagccaggccgacgccaaggagctcaaggac
ctgctgaactggatggtcaccaccgggcagcagtacaacgagccgctcgactacgccaag
cttcccagcagcgtggtgaacaaggccaaggccctgatcaacagcatcaactacggcggc
gccaagctctaa

DBGET integrated database retrieval system