KEGG   Deinococcus irradiatisoli: DKM44_12515Help
Entry
DKM44_12515       CDS       T05530                                 

Gene name
feoB
Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
dez  Deinococcus irradiatisoli
Brite
KEGG Orthology (KO) [BR:dez00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dez02000]
    DKM44_12515 (feoB)
Transporters [BR:dez02000]
 Other transporters
  Others
   DKM44_12515 (feoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate MMR_HSR1 FeoB_C FeoB_Cyto AIG1 Dynamin_N AAA_16 SRPRB AAA_29 TniB AAA
Motif
Other DBs
NCBI-ProteinID: AWN23948
UniProt: A0A2Z3JRG5
Position
2540939..2543146
Genome map
AA seq 735 aa AA seqDB search
MPVSPRTDAAACAATVARLRAQREPRALVVGNPNTGKSTLINAVAGTRLKVGNWSGVTVE
KREARLQRGEQMIHLLDLPGAYSLSPHTPEELITRTALLDEAPDVLLNVVDAGNLERNLY
LTLQLLEFRVPLTLALNLVDEARNKGLEVNAVLLGRELGVPVVETVGSKGIGTANLLGTT
LTGAQVGHPLRYPAPIEAAATDLERRMQPLQTLPPHAHRYLALALLEGDPSLRGRLSATG
HAELVDAADAHRAALELGGHDPLIEIAEARYARAGEIARLASPRSELKLTLTEKLDKLAL
HPWLGIPIFLALVLLVFRLTFTVAAPFVDLIGGPLQEVASGWAAGLLGWAPLLKDIVVGA
IIPGVGTVLSFLPTLLVLYLAMSFLEDSGYMARAAFLADRSMRGLGLDGRAFIPLILGFG
CNVPAVYATRTLERRSDRVLVSMILPFMSCSARLPVYVIFSAALFPRAGAWVVWSMYVLG
MAVAFAFAWVLRKTSLPAEGSGVLLELPPYRFPAWKVMWTHAARRTASFAKRARTTVLAT
VAAVWVLLSVPAVGGQAFGQVAPAQSLFGRVSEAISPVFAPLGFGNWQATGALVPGFIAK
EVVVGTLGQIYLGEQAAQVRPLGALDGLKQTTLATWDAVKTSVSALPTLVALPSFGADSS
AEQKTPLAAALAAAFTPASGLAYLVFVLLYTPCVATIGAMQAEHGRRVAWLTVAYELGIA
WVAGLIVYQVARWFM
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctcgccgcgcaccgacgccgccgcctgcgccgccacggtggcccggctgcgc
gcccagcgcgagccgcgcgccctggtggtgggcaaccccaacaccggcaaatccaccctg
atcaacgcggtggccggcacccggctcaaggtgggcaactggtcgggcgtcacggtggaa
aagcgcgaggcgcggctgcagcgcggcgagcagatgattcacctgctcgacctgcccggc
gcctactcgctctcgccgcacacgcccgaggaactcatcacccgcaccgccctgctcgac
gaagcgccggacgtgctgctcaacgtggtggacgccggcaacctggagcgcaacctctac
ctcacgctgcaactgctggaattccgggtgccgctgaccctggcgctgaacctggtggac
gaggccagaaacaagggcctggaagtgaacgccgtgctgctgggccgcgaactcggcgtg
ccggtggtcgaaacggtgggcagcaagggcatcggcaccgccaacctgctcggcaccacc
ctgaccggcgcccaggtgggccacccgctgcgctacccggcaccgatcgaagcggccgcc
accgacctcgaacggcgcatgcagcccctgcagaccttgccgccgcacgcgcaccgctac
ctggccctggccctgctggaaggcgacccgagtctgcgcggccgcctgagcgccaccggg
cacgccgaactggtggacgctgccgacgcgcaccgcgccgcgctggaactcggcggccac
gacccgctgatcgagatcgccgaggccagatacgcccgcgccggagaaatcgcccggctg
gcctcgccgcgctcggaactcaagctgaccctcaccgagaagctcgacaaattggcgctg
cacccctggctgggcatcccgattttcctggcgctggtgctgctggtgttccggctgacc
ttcacggtggccgcgccgttcgtggacctgatcggcgggccgctgcaggaagtggccagc
ggctgggcggcgggcctgctgggctgggcgccgctgctcaaagacatcgtggtgggcgcg
atcattcccggcgtgggcacggtgctgagtttcctgcccaccttgctggtgctctacctc
gccatgagctttctggaagacagcggctacatggcccgcgccgctttcctggccgaccgc
agcatgcgcggcctgggcctcgacgggcgggccttcattccgctgattctgggcttcggc
tgcaacgtgccggccgtgtacgccacccgcaccctggagcggcgcagcgaccgggtgctg
gtcagcatgattttgccgttcatgagctgctcggcgcggctgccggtgtacgtgatcttc
tcggcggcgctatttccccgtgccggggcctgggtggtctggagcatgtacgtgctgggc
atggcggtggcctttgccttcgcctgggtgctgcgcaaaacctccctgccggccgagggc
agcggcgtgctgctcgaactcccgccctaccgctttccggcctggaaagtgatgtggacc
cacgcggcccggcgcaccgccagctttgccaagcgtgcccgcaccaccgtgctggcgacc
gttgcggcggtgtgggtgctgctgtcggtgccggcggtcggcgggcaggccttcgggcag
gtggccccggcccaaagcctcttcggacgggtcagcgaggccatcagcccggtgttcgcg
ccgctgggcttcggcaactggcaggccaccggcgcgctggtgccgggctttatcgccaag
gaagtggtggtgggcacgctggggcagatctacctgggcgagcaggcggcccaggtgcgg
ccgctgggcgccctggacggcctgaagcagaccaccctggcgacctgggacgcggtgaag
acctcggtcagcgccctgccgaccctggtcgcgctgccgagcttcggggccgattcgagc
gccgagcagaaaaccccgctggccgccgcgctggctgccgccttcaccccggcctcgggg
ctggcctacctggtgttcgtgctgctctacaccccctgcgtcgccaccatcggagcgatg
caggccgaacacggccgccgggtggcctggctgacggtggcctacgaactcggcatcgcc
tgggtggccgggttgatcgtgtatcaggtggcccggtggttcatgtga

DBGET integrated database retrieval system