KEGG   Cavenderia fasciculata (cellular slime mold): DFA_01300
Entry
DFA_01300         CDS       T02668                                 

Definition
(RefSeq) Physaropepsin
  KO
K20756  physarolisin [EC:3.4.21.103]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dfa01002]
    DFA_01300
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.103  physarolisin
     DFA_01300
Peptidases and inhibitors [BR:dfa01002]
 Serine peptidases
  Family S53
   DFA_01300
SSDB
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Other DBs
NCBI-GeneID: 14872720
NCBI-ProteinID: XP_004359266
UniProt: F4PRY0
Position
Unknown
AA seq 603 aa
MASLLAFCQVFIVDQGLMIQLFVLVAVAMCLALPSLSAPTYRDYSYWTRSTRASKHAVID
FQVALTQRNIDVADQLLIDISTPSSPNYGNHMSIDEILDLVAPPAPVSEEIVNFLEMNGC
YNVENHRDMIKASARVEDVEALFEVEMYTYKHITNKKMTIVRSGESYKIPSQYADQIQMV
AGISELPHQTTRPAPKKVDISKSDPGLVIPQTLYNLYNIPTGYQNNANTSLCLAEFQDDQ
SFNKKDLASFAKETAITPINVTNIVGPYSPSSPDGESTLDVQYGGAVAQTANIWFWTVQG
WMYEFSTALFATTPAPWVVSMSWGWPENLQCQSGVASCTNGETSEQYVQRVNTEFLKIGL
RGISLLAASGDQGAPGDGSPGCNNKKKPLSTIFPGASPYVTSVGATMLNAPTTAATPVGA
AQPPICSKQKCATSTSETTCTYPDALITTGGGFSDYSPVPSWQASAVNAYLKSGVALPPS
QYFNSSNRGFPDVSALGHNYAIFLSGGIEQVDGTSCSSPVFGGMIALLNSYRLNNKKPTL
GFLNPLIYSAPSNCWNDITTGNNKCTESCCSKYGYLATAGWDPLTGRGTPNFANLLTYVK
TLN
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggcttctttacttgcattttgtcaagtatttatcgtagatcaaggattgatgatacaa
ctatttgtattagtagctgtcgctatgtgcttggcattgccatcactctctgccccaacc
taccgtgactattcatattggacccgttctacccgtgcctccaagcacgctgtcatcgac
ttccaagtagccctcactcaaagaaacattgatgttgctgatcaacttcttatcgatatc
tctactccatcttcaccaaactatggtaaccatatgtcaattgatgaaattttggacttg
gttgccccaccagctccagtttctgaagagattgttaacttccttgaaatgaacggatgt
tacaatgttgaaaaccaccgtgatatgatcaaggcctctgcccgtgttgaagacgttgaa
gccctctttgaggtcgaaatgtacacctacaagcacatcaccaacaagaagatgaccatc
gtccgttctggtgaatcatacaagatcccaagccaatacgctgaccaaatccaaatggtt
gccggtatctctgaattgccacaccaaacgactagaccagctccaaagaaggtcgacatc
tccaagtctgatccaggtcttgtcatcccacaaaccctctacaacctctacaacattcca
actggctaccaaaacaacgccaacaccagtttgtgtttggctgaattccaagacgaccaa
tctttcaacaagaaggatttggccagctttgccaaggagactgccatcaccccaatcaac
gtcaccaacatcgttggtccatactccccatccagcccagatggagagtcaaccctcgac
gtccaatacggaggtgctgtcgcccaaaccgccaacatctggttctggactgtccaaggt
tggatgtacgaattttccactgctttgtttgccaccactccagctccatgggtagtctcc
atgtcttggggttggccagagaacctccaatgccaatctggcgttgcttcatgcaccaac
ggtgaaacctctgaacaatacgtccaacgtgtcaacactgagttcctcaagattggcctc
cgtggtatctccctccttgccgcttcaggtgaccaaggtgctccaggtgatggatcccca
ggttgcaacaacaagaagaagccactctccaccattttcccaggtgcctccccatacgtc
acctctgttggtgccactatgttgaacgcccccaccaccgctgccaccccagtcggagct
gcccaaccaccaatttgctccaagcaaaagtgtgccacctccaccagtgaaactacctgc
acctacccagatgccctcatcactaccggtggtggtttctctgactactccccagtccca
tcatggcaagcatctgccgtcaacgcctacctcaagtctggtgttgccctcccaccaagc
caatacttcaactcctccaacagaggtttcccagatgtatctgctcttggtcacaactac
gccatcttcctctctggtggcatcgaacaagttgatggtacctcttgctcatccccagtc
tttggtggtatgattgctctcctcaactcttaccgtttgaacaacaagaagccaaccctc
ggtttcctcaacccactcatctactctgctccatccaactgttggaacgatattaccacc
ggtaacaacaagtgtactgaatcctgttgctccaagtatggttacctagctaccgctggt
tgggatccactcactggtcgtggtactccaaactttgccaacttgctcacctacgtcaag
accctcaactaa

DBGET integrated database retrieval system